Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or8k22 Olfactory Receptor

Gene Symbol Or8k22
Organism Mouse
Family 8
Subfamily k
Pseudo No
Location chr2:86332419-86333354 (-)
Aliases Olfr1054, RP23-222H15.6, MOR188-2, RP23-222H15.6, MOR188-2

Sequence information


Nucleotide sequence

ATGGAGAAACGCAACCTCACAGTAGTGACTGAATTCATACTGATGGGCATCACTGACAGG
CCTGAGCTTCAGGCTCCATTGTTCGGCTTGTTTCTCATCATCTATCTGATCTCACTGTTG
GGCAACATGGGCATGATCATCCTTACCATGGTGGACTCCCGATTGCAAACACCCATGTAC
TTCTTTCTCAGACATCTGGCTATCACTGATCTTGGTTATTCTACAGCTGTGGGACCCAAA
ATGCTGGAAAATTTTGTTGTCAATCAGAATACAATCAGTAATCATCTTTGTGCAATACAG
CTAACTTTCTTTCTTGTGTTCATCATTTGTGAACTCTTTATTCTCTCTGCAATGTCCTAT
GACCGCTATGTGGCCATCTGTAAGCCTCTACTCTATACTGTCATCATGTCCCATAGGGTA
TGCTGGGTCCTAGTGGCAGTTCCTTATTTCTATAGTGTCATTATTTCTCTTCTAATAACT
ATAAAAATTTTTGCTTTACCTTTTTGTGATTACAGGATCGTTAGTCATTTCTGCGATAGT
CTCCCTTTAATATCATTGCTCTGTTCTAATACACATGATATTGAAATTATAATATTGATT
TCAGCGGGGTTTAATTTGGTTTCATCTCTCGTGGTACTCCTCTTTTCTTATCTACTCATT
CTTATAGCCATTTTTAGAATGAATTCAGCTGAAGGCAGGCAGAAAGCTTTGTCTACTTGT
GGATCCCACTTGACAGTGGTCATTGTCTTCTATGGGACTTTGATATTTATGTATGTGCAG
CCCAAATCAAGTCACTCATTTGACACTGATAAGGTGGCTTCCATCTTTTATACTCTGATT
ATCCCCATGTTGAATCCCTTGATCTATAGTCTAAGGAACAAAGATGTAAAATATGCCCTA
GAAAGGTTGTGGAAAATGTTAGGCAATATTTTTTCT


Conceptual translation

MEKRNLTVVTEFILMGITDRPELQAPLFGLFLIIYLISLLGNMGMIILTMVDSRLQTPMY
FFLRHLAITDLGYSTAVGPKMLENFVVNQNTISNHLCAIQLTFFLVFIICELFILSAMSY
DRYVAICKPLLYTVIMSHRVCWVLVAVPYFYSVIISLLITIKIFALPFCDYRIVSHFCDS
LPLISLLCSNTHDIEIIILISAGFNLVSSLVVLLFSYLLILIAIFRMNSAEGRQKALSTC
GSHLTVVIVFYGTLIFMYVQPKSSHSFDTDKVASIFYTLIIPMLNPLIYSLRNKDVKYAL
ERLWKMLGNIFS