Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or8k24 Olfactory Receptor

Gene Symbol Or8k24
Organism Mouse
Family 8
Subfamily k
Pseudo No
Location chr2:86385469-86386416 (-)
Aliases Olfr1058, RP23-222H15.10, MOR190-2, RP23-222H15.10, MOR190-2

Sequence information


Nucleotide sequence

ATGGAGAACCATAACCTCACAATGGTGACTGAATTCATCCTGATGGGCATCACTGCCTGC
CCTGAACTGCAGCCTCCATTATTTGTACTTTTCCTCATAATCTATCTGATATCTCTGATT
GGCAACTTGGGCATGATCATCCTTACCTTGGTGGACTCCAGACTACAAACACCCATGTAC
TTTTTTCTCAGACACCTCTCTACTACAGACCTTGGTTATACAACAGCTGTGGGACCAAAA
ATGTTACAAAATTTTCTTGTAGATCAAAATACAATATCATTTCATCTTTGTGCGATCCAG
TTGTCTTTCTTTAGTATGTTCATTGCTTGTGAAATTTATATTCTGTCTGCAATGTCCTAT
GACCGCTATGTGGCTATCTGTAAGCCTCTGTTCTATATGGTCATCATGTCAAAAAGACTA
TGCTTGGTGCTTGTAGTAATCCCTTATGTCTACTGTACAATTGTGGCTCTTTTAATCACA
ATTAAGATTTTCACTTTGTCTTTCTGTGGCTCCAATGTCATTAGTCATTTCTACTGTGAC
AGTCTTCCTTTGTTATCTTTGGTCTGCTCAAATACACAAGAAATTGAGGTGATATTGTTG
TACTTATCAGCTTTTAATTTGATTTCCTCTCTTCTGCTTGTTCTTGTGTCCTACCTGCTC
ATTCTCATAGCTATTATCAGGATGCACTCTGCTGAGGGCAGGCGCAAGGCTTTCTCTACC
TGTGGGTCCCACCTGACAATGGTCACTGTCTTCTATGGGACTTTGATATTTATGTATATG
CAGCCCAAATCCAGTCATTCCTTTGATACTGATAAAGTGGCTTCAATATTTTATACCATG
GTTATCCCCATGTTGAATCCCTTGATCTACAGCTTGAGAAATAAAGATGTAAAAGATGCT
CTCCATAGAACATTGAAAAAAATACATGGTTTTCTTTTGAAATTGACA


Conceptual translation

MENHNLTMVTEFILMGITACPELQPPLFVLFLIIYLISLIGNLGMIILTLVDSRLQTPMY
FFLRHLSTTDLGYTTAVGPKMLQNFLVDQNTISFHLCAIQLSFFSMFIACEIYILSAMSY
DRYVAICKPLFYMVIMSKRLCLVLVVIPYVYCTIVALLITIKIFTLSFCGSNVISHFYCD
SLPLLSLVCSNTQEIEVILLYLSAFNLISSLLLVLVSYLLILIAIIRMHSAEGRRKAFST
CGSHLTMVTVFYGTLIFMYMQPKSSHSFDTDKVASIFYTMVIPMLNPLIYSLRNKDVKDA
LHRTLKKIHGFLLKLT