Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or8k25 Olfactory Receptor

Gene Symbol Or8k25
Organism Mouse
Family 8
Subfamily k
Pseudo No
Location chr2:86413112-86414050 (-)
Aliases Olfr1061, MOR188-1, MOR188-7, MOR188-9, Olfr1515, MOR188-1, MOR188-7, MOR188-9, Olfr1515

Sequence information


Nucleotide sequence

ATGGAGAAATATAATCTTACAATAGTGACTGAATTCATCCTGGTGGGCATCACTAACCAC
CATGAGTTTCAGGTACCATTGTTTGGACTGTATCTCATCATTTATCTGACCTCACTGGTC
GATAACTTGGGCATGATAATCCTTACCATAGTGGATTCCAGGCTGCAAACACCCATGTAC
TTCTTTCTCAGACACCTCGCTACTACTGACCTTGGTTATTCAACAGCTGTGGGACCAAAA
ATGTTGAGAAATTTTCTTGTAGATCAAAATATAATATCATTTTATGCCTGTGCTATCCAA
TCATCTTTCTTTGGTATGTTCATTGTTTGTGAATTTTTTATTCTTTCTGCAATGTCTTAT
GACCGTTATGTGGCCATCTGTAAACCACTCCTCTACACTGTCATCATGTCACAAAAAGCA
TGTTGGATACTAGTCACCATTCCCTATCTCTACAGTATAATTGTCTCACTTCTAGTTAAC
ATAAAGATTTTCACTTTATCCTTCTGTGGCTACAATGTCATCAGTCATTTCTACTGTGAT
GCCCTCCCTTTGTTAACTTTGGCCTGCTCAAACACACATGAAATTGAGGCGATAATTTTA
ATCTTCTCAGCTTTTAATTTGCTTTCATCTCTTCTTATAGTAATTGGTTCCTATCTACTT
ATCCTTATGGCAATTCTAAGGATTAACTCTGCTGAGGGCAAATGGAAGGCTTTCTCTACG
TGTGGGTCCCACCTGACAGTTGTCATCGTCTTTTACGGGACTTTGATATTTATGTATTTG
CAGCCTACATTCACTCACTCCATTGACACTGGTAAAGTGATTTCCATCTTTTACACCCAG
GTTATCCCTATGTTGAATCCCTTAACATACAGCTTGAGGAACAAAGATGTAAAAGATGTC
CTTAAAAAACCAATGGAAAAAGTGCACAATCTTTTCTCA


Conceptual translation

MEKYNLTIVTEFILVGITNHHEFQVPLFGLYLIIYLTSLVDNLGMIILTIVDSRLQTPMY
FFLRHLATTDLGYSTAVGPKMLRNFLVDQNIISFYACAIQSSFFGMFIVCEFFILSAMSY
DRYVAICKPLLYTVIMSQKACWILVTIPYLYSIIVSLLVNIKIFTLSFCGYNVISHFYCD
ALPLLTLACSNTHEIEAIILIFSAFNLLSSLLIVIGSYLLILMAILRINSAEGKWKAFST
CGSHLTVVIVFYGTLIFMYLQPTFTHSIDTGKVISIFYTQVIPMLNPLTYSLRNKDVKDV
LKKPMEKVHNLFS