Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or8k25 Olfactory Receptor

Gene Symbol Or8k25
Organism Rat
Family 8
Subfamily k
Pseudo No
Location chr3:73735321-73736304 (-)
Aliases Olr500, Olr500

Sequence information


Nucleotide sequence

ATGATGCTGTTACCTCTCCTCAGGACAGGATTTATGACCATCTCTAATGGAGAAATACAA
TCTCAAACGTTGACTGAATTCATCCTGATGGGCATCACTTACCACGCTGAGCTTCAGGTC
CCATTGTTTGGATTATTCCTCATCATTTATTTGACCTCACTGGTCGGCAACCTGGGCATG
ATCATCCTTACCATGATGGATTGTAGGCTACAAACACCCATGTATTTCTTTCTTAGACAC
CTCGCTACTACAGATCTTGGTTATTCAACAGCTGTGGGACCAAAAATGTTAAGCAATTTT
CTTGTAGATCAAAATACAATATCCTTTCAGGATTGTGCTATCCAGTCAGCTTTCTTTAGT
ATGTTCATTGTTAGTGAATTTTTTATTCTCTCTGCAATGTTTTATGACCATTATGTAGCC
ATCTGTAAACCACTTCTCTACACCATTATCGTGTCACAAAAAGTATGTTGGATACTAGTC
ACCATCCCCTATCTCTATAGTATAATTGTCTCACTTCTAGTTAACATAAAGATTTTCACT
TTATCCTTCTGTGGCTACAATGTCATCAATCATTTCTACTGTGATGCTCTCCCTTTGTTA
TCTTTGGCCTGCTCAAATACACATGAAATTGAGGTGATAATTTTAGTCTTCTCAGCTTTT
AATTTGCTTTTGTCTCTTCTCAAAGTAATTGGGTCCTATCTACTTATACTTAAGGCAATT
CTAAGTATTAATTCTGCTGAGGGCAAACGGAAGGCTTTCTCTACATGTGGGTCCCACCTG
ACGGTAGTCATTGTCTTTTATGGAACTTTGATATTTATGTATTTACAACCTGCATCCACT
CACTCTATTGACAGTAATAAAGTGACTTCCATCTTTTACACCCAGGTTATTCCTATGTTG
AATCCCTTAATATACAGCTTGAGGAACAAAGATGTAAAAGATGCCCTTAAAAAAACAATG
GAGAAAGTACACAATCTTGTCTCG


Conceptual translation

MMLLPLLRTGFMTISNGEIQSQTLTEFILMGITYHAELQVPLFGLFLIIYLTSLVGNLGM
IILTMMDCRLQTPMYFFLRHLATTDLGYSTAVGPKMLSNFLVDQNTISFQDCAIQSAFFS
MFIVSEFFILSAMFYDHYVAICKPLLYTIIVSQKVCWILVTIPYLYSIIVSLLVNIKIFT
LSFCGYNVINHFYCDALPLLSLACSNTHEIEVIILVFSAFNLLLSLLKVIGSYLLILKAI
LSINSAEGKRKAFSTCGSHLTVVIVFYGTLIFMYLQPASTHSIDSNKVTSIFYTQVIPML
NPLIYSLRNKDVKDALKKTMEKVHNLVS