Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or8k26-ps Olfactory Receptor

Gene Symbol Or8k26-ps
Organism Mouse
Family 8
Subfamily k
Pseudo Yes
Location chr2:86434314-86435231 (-)
Aliases Olfr1063-ps1, MOR190-3P, MOR190-3P

Sequence information


Nucleotide sequence

ATGGTGACTGAATTCATCCTGGTGGGCATCACTGACCGCCCTGAGCTGCAGGCCCCATTG
TTTGGACTGTTCCTCCTCATCTATCTGATCTCTCTGATTGGCAACTTGGGCATGATCATC
TTTACCATGGTGAATTCCAGGCTGAAAACACCCATGTACTTCTTTCTAAGACACCTCGCT
ACTACTGTCCTTGGTTATTCAACAGCCGTGGGACCAAAAATGTTACAAAATTTTCTTGTA
GATCAAAATACAATATCATTTCATCTTTGTGCGATCCAGTTGTCTTTCTTTAGTATGTTC
ATTGCTTGTGAAATTTATATTCTGTCTGCAATGTCCTATGACCACTATGTGGCTATCTGT
AAGCCTCTGTTCTATATGGTCATCATGTCAAAAAGACTATGCTGGGTGCTTGTAGTAATC
CCTTATGTCTACTGTACAATTGTGGCTCTTTTAATCACAATTAAGATTTTCACTTTGTCT
TTCTGTGGCTCCAATGTCATCAGTCATTTCTACTGTGACAGTCTTCCTTTGTTATCTTTG
GTCTGCTCAAATACACAAGAAATTGAGGTGGTGTTGTTGTACTTATCAGCTTTTAATTTG
ATTTCCTCTCTTCTGCTTGTTCTTGTGTCCTACCTGCTCATTCTCATAGCTATTCTCAGG
ATGAACTCTGCTGAGGGCAGGCGCAAGGCTTTCTCCACCTGAGGGTCCCACCTGACAATG
GTCACTGTCTTCTATGGGACTTTGATATTTATGTATATGCAGCCCAAATCTAATCATTCC
TTTGATACTGATAAAATGGCTTCAATATTTTATACCATGGTTATCCCCATGTTTAATCCC
CTGATCTACAGCTTGAGAAATAAAGATGTAAAAGATGCTCTCCTTAGGACATGGAAAAAA
AAATACATGGTTTTCTTT


Conceptual translation

MVTEFILVGITDRPELQAPLFGLFLLIYLISLIGNLGMIIFTMVNSRLKTPMYFFLRHLA
TTVLGYSTAVGPKMLQNFLVDQNTISFHLCAIQLSFFSMFIACEIYILSAMSYDHYVAIC
KPLFYMVIMSKRLCWVLVVIPYVYCTIVALLITIKIFTLSFCGSNVISHFYCDSLPLLSL
VCSNTQEIEVVLLYLSAFNLISSLLLVLVSYLLILIAILRMNSAEGRRKAFST*GSHLTM
VTVFYGTLIFMYMQPKSNHSFDTDKMASIFYTMVIPMFNPLIYSLRNKDVKDALLRTWKK
KYMVFF