Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or8k28 Olfactory Receptor

Gene Symbol Or8k28
Organism Mouse
Family 8
Subfamily k
Pseudo No
Location chr2:86455331-86456269 (-)
Aliases Olfr1066, MOR188-8, MOR256-52P

Sequence information


Nucleotide sequence

ATGGAGAAATATAATCTCACAATGGTGACTGAATTCATCCTGGTGGGCATCACTTACCAC
CCTGAGTTTCAGGTACCATTGTTTGGACTGTTCCTCATCATTTATCTGACCTCACTGTTT
GGCAACTTGGGCATGATCATCCTTACCATGGTGGATTCCGGGCTGCAAACACCCATGTAC
TTCTTTCTCAGACACCTTGCTACTACTGATCTTGGTTATTCAACAGCTGTGGGACCAAAA
ATGTTGAGAAATTTTCTTGTAGATCAAAATACAATATCATTTAATGCCTGTGATATCCAA
TCATCTTTCTTTAGTATGTTCATTGTTTGTGAATTTTTTATTCTTTCTGCATTGTCTTAT
GACTGTTATGTGGCCATCTGTAAACCACTCCTCTATACTGTCATCATGTCACAAAAAGTA
TGTTGGATACTAGTCACAATTCCCTATCTCTATAGTATAATTGTCTCACTTATAATTAAC
ATAAAGATTTTCACTTTATCCTTTTGTGGCTACAATGTCATCAGTCATTTCTACTGTGAT
GCTCTCCCTTTGTTAACTTTGGCCTGCTCAAACACACATGAAATTGAGGCAATAATTTTA
ATCTTCTCAGCTTTTAATTTGCTTTCGTCTCTTCTTATAGTAATTGGGTCCTATCTACTT
ATCCTTATGGCAATTCTAAGGATTAACTCTACTGAGGGTAAATGGAAGGCTTTCTCTACG
TGTGGGTCCCACCTGACAGTTGTCATCGTCTTTTATGGGACTTTGATATGTATGTATTTG
CAACCTACATCCACTCACTCCATTGACACTGGTAAAGGGACTTCCATCTTTTACACCCAG
GTTATCCCTATGTTGAACCCCTTAATATACAGCTTGAGGAACAAAGATGTGACAGATGTC
CTTAAAAAAACAAAGGAAAAAGTGTACAATCTTGTCTCA


Conceptual translation

MEKYNLTMVTEFILVGITYHPEFQVPLFGLFLIIYLTSLFGNLGMIILTMVDSGLQTPMY
FFLRHLATTDLGYSTAVGPKMLRNFLVDQNTISFNACDIQSSFFSMFIVCEFFILSALSY
DCYVAICKPLLYTVIMSQKVCWILVTIPYLYSIIVSLIINIKIFTLSFCGYNVISHFYCD
ALPLLTLACSNTHEIEAIILIFSAFNLLSSLLIVIGSYLLILMAILRINSTEGKWKAFST
CGSHLTVVIVFYGTLICMYLQPTSTHSIDTGKGTSIFYTQVIPMLNPLIYSLRNKDVTDV
LKKTKEKVYNLVS