Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or8k29-ps Olfactory Receptor

Gene Symbol Or8k29-ps
Organism Mouse
Family 8
Subfamily k
Pseudo Yes
Location chr2:86463824-86464596 (-)
Aliases Olfr1069-ps1, MOR189-8_p

Sequence information


Nucleotide sequence

ATGGTGGATTCCAGGCTGCAAACACCCATGTATTTCTTTCTCAGACACCTACTACTATTC
AACAGCCAACAGCCGTGGGACCAAAAATGCTAAGAAATTTTCTTGTAGAACAAAATAAAA
AAATATTTTATGACTGTGCATTCCAGTCATCTTTCTTCAGTTCATTGTAAGTGAATTTTT
TTATTCTGTCTGCAATATCTTATGACTGTTATGTTGCCACCTGTAAACCACTCAACTATA
ATGTCATTATGTCACAAAGAGTATGTTGGATCCTGGTGGCAGTCCCATACCTTTACAGTA
TATTTGTTGCTCTCATAGTCACCATAAATATTTTTCCTTCTTCCTTCTGTGGCCCCAACA
TTATCAATCGTTTCTTTTATAATGGTACACCCTTGATATCTCTGCTCTGCTCATATAGAA
AGGAAAATGAAATGATAATGTTTATTTTATCAACTATTAACTTGATTTCTTCACCACTGG
TCATTCTTGTCTCCTATCTGCTCATTCTTAGAGCTATTCTTAGAATGAACTCTACTGAGG
GCAGGCATAAGGCTTTCTCCACTTGTGGGTCTCATCTGAGAGTAGTCACTATCTTCTATG
GGACTTTGATATTTATGTACAACCTAAATTACTGTATTAATTACAACCTAATTTCAGTCA
CACCTTAGACACTGACAAGGTGGTTTCCATCTTTTATACCTTAATAACCCCCCATGTTGA
ATCCCCTGATTTACAGCTTGAGAAATAAAGATGTAAAATATGTTCTTAGAAAA


Conceptual translation

MVDSRLQTPMYFFLRHLLLFNS/TAVGPKMLRNFLVEQNKKIFYDCAFQSSFFSSL*VN
FFILSAISYDCYVATCKPLNYNVIMSQRVCWILVAVPYLYSIFVALIVTINIFPSSFCGP
NIINRFFYNGTPLISLLCSYRKENEMIMFILSTINLISSPLVILVSYLLILRAILRMNST
EGRHKAFSTCGSHLRVVTIFYGTLIFMYNLNYCINY/PNFSHTLDTDKVVSIFYTLITP
\LNPLIYSLRNKDVKYVLRK