Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or8k3 Olfactory Receptor

Gene Symbol Or8k3
Organism Mouse
Family 8
Subfamily k
Pseudo No
Location chr2:86228013-86228969 (-)
Aliases Olfr1047, RP23-232A21.10, MOR188-3, RP23-232A21.10, MOR188-3

Sequence information


Nucleotide sequence

ATGGGGAGACACAACCTTACAGTGGTGACTGAATTTGTCCTGATGGGCATCACTGACCGC
CCTGAGCTTCAGGCCCCATTGTTTGGACTATTTCTCATTATCTATCTAATTTCACTGATA
GGAAACTTGGGCATGATCATCCTCACCACAGTGGACTCCAAGCTACAAACACCTATGTAC
TTTTTTCTCAAACATCTGGCGATTACAGATCTTGGTTATTCTACATCCGTGGGACCCAAA
ATGTTAGTAAATTTTGTTGTGGATCAAAATACAATATCATTTAAACTTTGTGCCACACAG
CTTTCTTTCTTTCTTGTGTTCATTGTCAGTGAGCTCTTTATTCTGTCTGCTATGTCCTAT
GACCGCTATGTGGCCATCTGTAAGCCTTTGCTCTATACTGTCATTATGTCACAAAAGTTA
TGTTGGGTACTAGTGGCAATTCCTTATCTTTATTGCACATTTGTTTCTCTTCTAGTCACA
GTTAAGATTTTCACTTTGTCTTTCTGTGGCTACAATGTCATCAGTCATTTCTACTGTGAC
AGTCTCCCCTTGTTACCTCTGCTCTGCTCAGATACACATGACATTGAACTGATAATTTTA
ATCTTAGCAGCCTTTGATTTGATTTCATCTCTTCTGGTTGTCCTTGTGTCTTACCTGCTC
ATCCTCATAGCCATTGTGAGGATGAACTCTGCTGAGGGCAGGCGGAAGGCTTTCTCCACC
TGTGGGTCCCACCTGACAGTAGTCATTGTCTTCTATGGGACTTTGATATTTATGTATGTG
CAGCCTAATTCCAGCCACTCCTTTGAAACTGATAAAGTGGCTTCCATATTCTACACACTG
GTGATCCCCATGTTGAATCCCTTGATATATAGTTTGAGAAACAAAGATGTAAAATATGCT
CTGAAAAGGACATTGAATAATTTGTGTAAGTTATTTTCTTTGGCATTTCATAAAATA


Conceptual translation

MGRHNLTVVTEFVLMGITDRPELQAPLFGLFLIIYLISLIGNLGMIILTTVDSKLQTPMY
FFLKHLAITDLGYSTSVGPKMLVNFVVDQNTISFKLCATQLSFFLVFIVSELFILSAMSY
DRYVAICKPLLYTVIMSQKLCWVLVAIPYLYCTFVSLLVTVKIFTLSFCGYNVISHFYCD
SLPLLPLLCSDTHDIELIILILAAFDLISSLLVVLVSYLLILIAIVRMNSAEGRRKAFST
CGSHLTVVIVFYGTLIFMYVQPNSSHSFETDKVASIFYTLVIPMLNPLIYSLRNKDVKYA
LKRTLNNLCKLFSLAFHKI