Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or8k30-ps Olfactory Receptor

Gene Symbol Or8k30-ps
Organism Rat
Family 8
Subfamily k
Pseudo Yes
Location chr3:73742847-73743986 (-)
Aliases Olr501-ps, Olr501-ps

Sequence information


Nucleotide sequence

TTATTTAAGCTACTTTAGATAATAAAACTCAGCAAATGCCTTTTGAAATCTATTGACTGT
TTAATGCTTTCCACTCAAAACAGAATTTCTCATAAACCTTATGGAGAAACGCAACTTCAC
AATGGTGACTGAATTCATCCTGGTGGGCATCACTGACCGCCCTGAGCTGCAGGCCCCATT
ATTTGGACTATTTCTCATCATCTATCTGATCACTGGTGGGAAACTTGGGCATGATCATAC
TTACCATGGTGGAATCGAGGTTACAAACACCCATGTACTTTTTTCTCAGACACCTTGCTA
CTACTGACCTTGGTTATTCAACAGCTGTGGGACCAAAAATGTTAAGAAATTTTCTTGTAG
AACAAAACACAATATCATTTTATTTTTGTGCTGTCCAGTTGTCTTTCTTCAGTATGTTCA
TTGTTAGTGAATTTTTTATTCTCTCTGCAATGTCTTATGACCGCTATGTTGCCATCTGTA
AGCCACTCCTCTATAATGTCATTATGTCACAAAGAGTGTGTTGGGTCCTGGTGGCAATCC
CATACCTTTATAGTATATTTGTTGCTCTCATAGTAACCATAAATATTTTTTCTTCAAACT
TTTGTGGCCATAATATTATCAGTCATTTTTACTGTGATGGTCTTCCCTTGATATCTCTCC
TCTGTTCAAATAAAATGGAAAGTGAAATGATAATATTAATTTTATCAACTATTAACTTGA
TTTCTTCACCACTGGTCATTCTTGTTTCCTATCTGCTCATTCTCAGAGCTATTCTCAGGA
TGAACTCTGCTGAGGGTAGGCAGAAGGCTTTCTCCACCTGTGGGTCTCATCTGACAGTTG
TCACTGTCTTCTATGGCACTTTGATTTTTATGTACGTGCAACCTAAGTCTAGTCACTCCT
TAAACACTGACAAGGTGGCTTCCATCTTTTATACCTTAATCATCCCCATGTTAAATCCCT
TGATCTACAGCTTGAGGAATAAAGATGTAAAATATGCTCTTAGAAAGACAGGGAAAACCA
TAAAAAATATCTTCTCTTAGAACTCATATTATTTAAGGTTATAATTCGTCAAATCAAATA
AATGTTATTGCTTTATAACTTACAGTGAAGAAAACATTAAAAAAACAATGTTTCCTTAAA


Conceptual translation

MEKRNFTMVTEFILVGITDRPELQAPLFGLFLIIYL\LVGNLGMIILTMVESRLQTPMY
FFLRHLATTDLGYSTAVGPKMLRNFLVEQNTISFYFCAVQLSFFSMFIVSEFFILSAMSY
DRYVAICKPLLYNVIMSQRVCWVLVAIPYLYSIFVALIVTINIFSSNFCGHNIISHFYCD
GLPLISLLCSNKMESEMIILILSTINLISSPLVILVSYLLILRAILRMNSAEGRQKAFST
CGSHLTVVTVFYGTLIFMYVQPKSSHSLNTDKVASIFYTLIIPMLNPLIYSLRNKDVKYA
LRKTGKTIKNIFS