Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or8k30 Olfactory Receptor

Gene Symbol Or8k30
Organism Mouse
Family 8
Subfamily k
Pseudo No
Location chr2:86,508,500-86,509,400 (+)
Aliases Olfr1076

Sequence information


Nucleotide sequence

MENHNLTMVTEFILVGITDRPELQAPLFGLFLIIYLITLVGNLGMIILTMVDSRLQTPMY
FFLRHLATTDLGYSTAVGPKMLRNFLVEQNTISIYFCAVQLSFFSMFIVSEFFILSAMSY
DWYVAICKPLLYNVIMSKRVCWLLVAIPYLYSIFVALIVTINIFSSSFCGHNIISHFYCD
GLPLISLLCSNKKESEMIILILSTINLISSPVVILVSYLLILRAILKMNSAEGRQKAFST
CGSHLTVVTVFYGTLIFMYVQPKSNHTLNTDKVASIFYTLIIPMLNPLIYSLRNKDVKYA
LRKTGKSIQNIFS


Conceptual translation

MENHNLTMVTEFILVGITDRPELQAPLFGLFLIIYLITLVGNLGMIILTMVDSRLQTPMY
FFLRHLATTDLGYSTAVGPKMLRNFLVEQNTISIYFCAVQLSFFSMFIVSEFFILSAMSY
DWYVAICKPLLYNVIMSKRVCWLLVAIPYLYSIFVALIVTINIFSSSFCGHNIISHFYCD
GLPLISLLCSNKKESEMIILILSTINLISSPVVILVSYLLILRAILKMNSAEGRQKAFST
CGSHLTVVTVFYGTLIFMYVQPKSNHTLNTDKVASIFYTLIIPMLNPLIYSLRNKDVKYA
LRKTGKSIQNIFS