Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or8k30b Olfactory Receptor

Gene Symbol Or8k30b
Organism Rat
Family 8
Subfamily k
Pseudo No
Location chr3:73,754,600-73,755,500 (-)
Aliases Olr502

Sequence information


Nucleotide sequence

ATGGAGAGCCACAACTTCACAATGGTGACTGAATTCATCCTAGTGGGTATCACTGACTCA
TCCGAGCTACAGGTCCCACTGTTTGGACTATTCCTTTTCATCTATCTCATCACACTGGTG
GGAAACTTGGGCATGGTCATCCTTACCATGGTGGAATCAAGGCTACAAACACCCATGTAT
TTCTTTCTCAGGTACCTTGCTACTACTGATCTTGGTTACTCAACAGCTGTGGGACCAAAA
ATGTTAAGAAATTTTCTTGTAGAACAAAATACAATATCATTTTATTTTTGTGCTGTCCAG
CTGTCTTTCTTCAATATGTTTATTGTTAGTGAATTTTTTATTCTCTCTGCAATGTCTTAT
GACCGTTATGTCGCCATCTGTAAGCCACTCCTCTATAATGTCATTATGTCACCAAGAATG
TGTTGGGTCCTGATAGCAATCACATACCTTTATAGTATATTTGTTGCTCTCATAGTAACC
ATAAATATCTTTTCTTCACCCTTCTGTGGCCACAATATTATCAACCATTTCTACTGTGAT
GGTCTTCCTTTGATATCTCTGCTCTGCTCATATAAAAAGGAAAATGAAATGATAATTTTA
ATTTTATCAACTATTAACTTGATTTCTTCACCACTGGTAATTCTTACCACCTATCTGCTT
ATTCTCAGAGCTATTTTCAGGATGAACTCTTCTGAGGGAAGGCAGAAGGCTTTCTCCACC
TGTGGATCTCATCTGACAGTTGTCACTGTCTTCTACGGGACTTTGATTTTTATGTATGTG
AGACCTAAGTCCAGTCCCTCCTTGAATAATGACAAGGTGGCTTCCATCTTTTATGCCCTG
ATAATACCCATGTTAAATCCCTTGATCTACAGCTTGAGGAATAAGGATGTAAAATATGTT
CTTAGAAAGACAGGGAAAACCTTACAAAATATCTCCTCC


Conceptual translation

MESHNFTMVTEFILVGITDSSELQVPLFGLFLFIYLITLVGNLGMVILTMVESRLQTPMY
FFLRYLATTDLGYSTAVGPKMLRNFLVEQNTISFYFCAVQLSFFNMFIVSEFFILSAMSY
DRYVAICKPLLYNVIMSPRMCWVLIAITYLYSIFVALIVTINIFSSPFCGHNIINHFYCD
GLPLISLLCSYKKENEMIILILSTINLISSPLVILTTYLLILRAIFRMNSSEGRQKAFST
CGSHLTVVTVFYGTLIFMYVRPKSSPSLNNDKVASIFYALIIPMLNPLIYSLRNKDVKYV
LRKTGKTLQNISS