Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or8k31-ps Olfactory Receptor

Gene Symbol Or8k31-ps
Organism Mouse
Family 8
Subfamily k
Pseudo Yes
Location chr2:86525237-86526175 (-)
Aliases Olfr1077-ps1, MOR189-4P

Sequence information


Nucleotide sequence

ATGGAAAACCACAGCCTCACATTGGTGACTGAATTCATCCTGATGGGTATAACTGAACGC
CCTGAACTGCAGGCCCCATTGTTTGGACTGTTCCTCATCATCTATATTTTCTCACTGGTG
GGCAACTTGGGCATGATCATCCTTACCATGGTGGAATCAAGGCTACAAACACCTATGTAC
TTTTTTCTCAGACACCTTGCTACTACTGACCTTGGTTATTCAACAGCTGTGGGACCAAAA
ATGTTAAGAAGTTTTCTTGTAGACCAAAATAGAATATCATTTCATTTCTGTGCTGTCCAG
TTTGCTTTCTTTAGCATGTTCATTATTAGTGAATTTTTTATTCTGTCTGCAATGTCTTAT
GACCGTTATGTCGCCATCTGTAAACCACTCCTCTATAATGTCATTATGTCACAAAGAGTG
TGTTGGGTCCTAGTGACAATCCCATACCTTTAGAGTATATTTGTCGCTCTCATAGCCACC
ATAAATATTTTTTCTTCTTCCTTCTGTGGCCAAAATATTATCAACCATTTCTACTGTGAT
GGTCCTCCTTTGACAGCTCTGCTTTGCTCAAATAAAGAGGAAAGTGAACTCTTAAATTTA
ATATTATCAACTATTAACTTGATTTCTTCACCACTGGTCATCCTTGTTTCCTATCTGCTC
ATTCTCAGAGCTATTCTCAGGATGAACTCTGCTGAGGGCAGGCAGAAGGCTTTCTCCACC
TGTGGATCTCATCTGACAGTAGTTATTGTATTCTATGGGACATTGATTTTTATGTATGTG
CAACCTAAGTCCAGTCACTCCTTAAACACTGACAATGCAGCTTCTATTTTTTATACCCTA
ATCATCCTTATGTTGAATCCCTTGATCTACAGCTTAAGAAACAAAGATGTAAAATATTCC
ATTAGAAAAACAGGGAAAACCATACAAAATATCTTTTCC


Conceptual translation

MENHSLTLVTEFILMGITERPELQAPLFGLFLIIYIFSLVGNLGMIILTMVESRLQTPMY
FFLRHLATTDLGYSTAVGPKMLRSFLVDQNRISFHFCAVQFAFFSMFIISEFFILSAMSY
DRYVAICKPLLYNVIMSQRVCWVLVTIPYL*SIFVALIATINIFSSSFCGQNIINHFYCD
GPPLTALLCSNKEESELLNLILSTINLISSPLVILVSYLLILRAILRMNSAEGRQKAFST
CGSHLTVVIVFYGTLIFMYVQPKSSHSLNTDNAASIFYTLIILMLNPLIYSLRNKDVKYS
IRKTGKTIQNIFS