Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or8k32 Olfactory Receptor

Gene Symbol Or8k32
Organism Mouse
Family 8
Subfamily k
Pseudo No
Location chr2:86537969-86538913 (-)
Aliases Olfr1079, MOR189-1, MOR189-1

Sequence information


Nucleotide sequence

ATGCAGATGGAGAGCCAAAACCTCACAGTAGTGACTGAATTTATCCTCAGGGGCATCACT
GACCGCCCTGAGCTGCAGGTTCCATTGTTTGGACTGTTTTTCATGATCTATCTGATCTCA
CTGTTTGGCAACTTGGGCATGATCATCCTCACCATAGTGGAATCAAGGCTGCAAACACCT
ATGTACTTCTTTCTCAGACACCTAGCTATCACAGATCTTGGTTATTCAACTGCTATTGGA
CCTAAAATGTTAGCAAATTTTGTCGTCAGTAAAAATACAATATCTTTTCATCTTTGTGCT
ACACAATTAGCCTTCTTTCTTCTGTTCATTGCTTGTGAACTGTTCATTCTATCTGTGATG
TCTTACGACCGCTATGTGGCTATCTGTAACCCTCTGCTCTACAATGTCATCATGTCACAA
ACTGTATGTTGGGTACTTGTAGCAATACCATACCTTTACAGTGTATTTATTTCTCTCATA
GTCACCATTAATATCTTCTCTTCATCCTTCTGTGGTTACAATGTCATCCCTCATTTCTAC
TGTGATGGTCTTCCCTTGATATCTCTGCTCTGCACAAATACAGATAAAATCGGACTGATA
ATTTTAATTTTATCTGCCATTAATTTGATTTCCTCTCTCCTGATCATCCTTGGCTCCTAT
CTGCTCATCTTCAGAGCTATTCTCAGAATGAACTCTGCTGAGGGAAGACGGAAGGCTTTC
TCCACCTGTGGCTCCCATCTGACCGTGGTTTCTGTCTTTTATGGGACTTTGATTTTTATG
TATGTGCAACCTAAGACCAGTCACTCCTTTGACACTGACAAGGTGGCTTCCATCTTCTAT
ACCCTAGTTATCCCTATGTTAAATCCTTTGATCTACAGTTTAAGAAACAAAGATGTGAAA
TATGCTCTTAGAAAGACAGGAAAAATTATACAAAATAATTTCTCA


Conceptual translation

MQMESQNLTVVTEFILRGITDRPELQVPLFGLFFMIYLISLFGNLGMIILTIVESRLQTP
MYFFLRHLAITDLGYSTAIGPKMLANFVVSKNTISFHLCATQLAFFLLFIACELFILSVM
SYDRYVAICNPLLYNVIMSQTVCWVLVAIPYLYSVFISLIVTINIFSSSFCGYNVIPHFY
CDGLPLISLLCTNTDKIGLIILILSAINLISSLLIILGSYLLIFRAILRMNSAEGRRKAF
STCGSHLTVVSVFYGTLIFMYVQPKTSHSFDTDKVASIFYTLVIPMLNPLIYSLRNKDVK
YALRKTGKIIQNNFS