Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or8k33 Olfactory Receptor

Gene Symbol Or8k33
Organism Rat
Family 8
Subfamily k
Pseudo No
Location chr3:73,838,600-73,839,500 (-)
Aliases Olr508

Sequence information


Nucleotide sequence

ATGGATAAACATAACATAACAGTGGTGACTGAATTCATCTTGATGGGAATCACTAAGAAC
CCTGACCTGCAGGCCCCATTGTTTGGGTTATTTCTCATTATTTACCTGACCTCAGTGACT
GGCAATCTGGGAATAATCATCCTTACCAATGTAGACTCCAAATTACAGACACCAATGTAT
TTCTTCCTTAGGCATTTGGCTTTCACTGACTTTGTTTACTCAACAACTGTGGGACCAAAA
ATGTTGGTAAATTTTGTTGTAGATCAAAATGCAATTTCCTACTATCTTTGTGCTACACAG
CTAGCTTTTTTCCTTCTCTTCATTGGCAGTGAGCTCTTTATTCTGTCTGCAATGTCCTAT
GACCGCTATGTGGCCATCTGTAAGCCTCTCCTCTACACTGTCATCATGTCACATAGGGTA
TGTTGGGTCCTAGTCACAATGACCTATCTTTACTGTACATTTATGTCACTTGTAGTCACC
ATAAATATTTTCTCTTTATCCTTCTGTGGCTATAATATCATCAATCATTTCTTTTGTGAC
TGTATCCCCTTAATATCTTTGGTTTGCTCAAACACACAAGAAGTTGAACTGATAGTTATG
ATCTTTGCAGCTTTTGATTTGATTTCCTCCCTTGTGGTTGTGCTTATGTCCTACCTGCTC
ATTCTCATAGCTGTTCTCAGGATGAACTCTGCTGCAGGCAGACGTAAAGCTTTCTCTACT
TGTGGGTCCCACTTGACAGTGGTTACAGTGTTCTATGGGACATTGATATTTATGTATGTA
CAACCTGAATCTAGTCATTCCATTGATACTGATAAAATATCATCCATTTTTTATACTCTA
ATCATCCCCTTGTTGAATCCCCTGATCTATAGCCTGAGGAACAAAGATGTAAAAGATGCC
CTACAAAGAACCTGGCAAAAAATATTCACCATATTTTCT


Conceptual translation

MDKHNITVVTEFILMGITKNPDLQAPLFGLFLIIYLTSVTGNLGIIILTNVDSKLQTPMY
FFLRHLAFTDFVYSTTVGPKMLVNFVVDQNAISYYLCATQLAFFLLFIGSELFILSAMSY
DRYVAICKPLLYTVIMSHRVCWVLVTMTYLYCTFMSLVVTINIFSLSFCGYNIINHFFCD
CIPLISLVCSNTQEVELIVMIFAAFDLISSLVVVLMSYLLILIAVLRMNSAAGRRKAFST
CGSHLTVVTVFYGTLIFMYVQPESSHSIDTDKISSIFYTLIIPLLNPLIYSLRNKDVKDA
LQRTWQKIFTIFS