Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or8k34-ps Olfactory Receptor

Gene Symbol Or8k34-ps
Organism Mouse
Family 8
Subfamily k
Pseudo Yes
Location chr2:86567123-86568064 (-)
Aliases Olfr1081-ps1, MOR191-4_p

Sequence information


Nucleotide sequence

ATGGAGAAACAGAATCTCACAGTGCTGAGTGAATTCATTTTGAAAGGCATCACTGACCAT
CCTGAGCTGCAGGCCCCACTCTTTGGGTTGCTCTTCATTATCTATCTGATCTCAGCAGTG
GGTAATTTGGGCATCATCATTATTACTAACGTGGACTCCAGGCTCTGCACACCCATGTAC
TTTTTTTTCTCAAACATCTGGCTTTCACTGATCTTGGATATTCCACAGCCATTGGACCAA
AAATGTTAGTTAATTTTGTTGCAGAGCATAATTCAGTCTCCTATTATCTTTGTGCTACAC
AGTTAGCTTGCTTTCTTCTTTTTATTACTTGTGAACTTTTTATTCTTTCTTCAATGTCTT
ATGACTGTTACGTGGCTATATGTAACCCTCTTCTCTATACTGTCATCATGTCACAAAGAA
TATGTTGGGTACTTGTGGCGGTCCCATATATCTACAGTGTATTTGTATCTCTAATTGTCA
CAATAAGATTATTCACTTTATCCTTTTGTGGTTAGCATATCATCAATCATTTTTTTCTGT
GATTGTATCCCATTTATATCATTGCTCTGTTCAAATACACATGAGGTTGAAGTGATAATT
AGGTTCTTTGCAACATTTGATTTGATTTCCTCTCTTCTGGTTGTCCTCGTGTCTTATCTG
TTTATTCTCATAACTATTCTGAGGATGAAATCTGCTGCAGGCAGACGCAAAGCTTTTTCA
ACCTGTGGGTCTCACCTCACTGTGGTCATTGTCTTCTATGGGACTTTGATATTTATGTAT
GTGCAGCCTAAGTCCAGTCAAACATTTGAGACTGATAAAGTGTCTTCCATATTTTACACA
CTTGTTATCCCAATGTTGAATCCCTTGATCTATACCTTGAGGAATAAAGATGTAAAAGAT
GCCATAGAAAGGACCTGGGAAAAGATAGTTACCAGTTTTTCT


Conceptual translation

MEKQNLTVLSEFILKGITDHPELQAPLFGLLFIIYLISAVGNLGIIIITNVDSRLCTPMY
FFFSN/LAFTDLGYSTAIGPKMLVNFVAEHNSVSYYLCATQLACFLLFITCELFILSSM
SYDCYVAICNPLLYTVIMSQRICWVLVAVPYIYSVFVSLIVTIRLFTLSFCG*HIINHFF
\DCIPFISLLCSNTHEVEVIIRFFATFDLISSLLVVLVSYLFILITILRMKSAAGRRKA
FSTCGSHLTVVIVFYGTLIFMYVQPKSSQTFETDKVSSIFYTLVIPMLNPLIYTLRNKDV
KDAIERTWEKIVTSFS