Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or8k37 Olfactory Receptor

Gene Symbol Or8k37
Organism Mouse
Family 8
Subfamily k
Pseudo No
Location chr2:86638768-86639706 (-)
Aliases Olfr1084, RP23-449C14.1, MOR192-2, MOR192-3

Sequence information


Nucleotide sequence

ATGGATAAACACAACCTAACAGTTGTGACTGAATTCATCCTGATGGGAATCACTGAGAAC
CCTGAGCTGCAGGCTCCATTGTTTGGGTTGTTCCTAGTCATCTACCTGACCTCAGTGGTT
GGCAATCTTGGGATAATCATCCTCACCAATGTAGACGCCAAGCTACAGACACCAATGTAT
TTCTTTCTTAGGCATTTGGCTTTTACTGACTTTGTTTATTCAACAACTGTGGGACCAAAA
ATGTTGGTAAACTTTGTTGTAGATCAAAATGCAATTTCCTACTCTCTTTGTGCTACACCG
CTAGCTTTTTTTCTTCTGTTCATTGGCAGTGACCATTTTATTTTGTCTGCAATGTCCTAT
GACCGCTATGTGGCCATATGTAAGCCTCTGCTCTACACTGTCATCGTGTCTCATAAAGTA
TGTTGGCTTCTAGTCACAATGACCTATCTTTACTGTACATTTATGTCCCTTGTAGTCACC
ATAAATATTTTCTCTTTATCCTTCTGTGGCTACAATGTCATCAATCATTTCTTTTGTGAT
TGTATTCCCTTAATATCATTGCTTTGCTCAAATACACAAGAAGTTGAACTTATAGTTATG
TTCTTTGCAGCTTTTGATTTGATTTCTTCCCTTGTCGTCGTGCTTATGTCCTACCTGCTC
ATTCTCATAGCTGTTCTCAGGATGAACTCTGCTGAGGGCAGACGCAAAGCTTTCTCTACC
TGTGGGTCCCACCTGACAGTGGTTACAATATTCTATGGGACACTGATATTTATGTATGTA
AAACCTGTATCTAGTCATTCAATTGATACTGAAAAAATATCATCTATACTTTATACTCTA
ATCATCCCTTTATTGAATCCCCTGATCTACAGTCTGAGGAACAAAGATGTGAAAGAAGCT
TTACAAAGAACATGGCAAAAAATATTCAACACATTTTCT


Conceptual translation

MDKHNLTVVTEFILMGITENPELQAPLFGLFLVIYLTSVVGNLGIIILTNVDAKLQTPMY
FFLRHLAFTDFVYSTTVGPKMLVNFVVDQNAISYSLCATPLAFFLLFIGSDHFILSAMSY
DRYVAICKPLLYTVIVSHKVCWLLVTMTYLYCTFMSLVVTINIFSLSFCGYNVINHFFCD
CIPLISLLCSNTQEVELIVMFFAAFDLISSLVVVLMSYLLILIAVLRMNSAEGRRKAFST
CGSHLTVVTIFYGTLIFMYVKPVSSHSIDTEKISSILYTLIIPLLNPLIYSLRNKDVKEA
LQRTWQKIFNTFS