Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or8k38 Olfactory Receptor

Gene Symbol Or8k38
Organism Rat
Family 8
Subfamily k
Pseudo No
Location chr3:73,853,700-73,854,500 (-)
Aliases Olr509-ps

Sequence information


Conceptual translation

MEKQNLTVVTEFILKGITDRPELQAPLFGLLFIIYLISAMGNLGIIILTNVDSRLQTPMY
FFLRHLALTDLGYSTAVGPKMLVNFVAEHNSVSYYLCATQLACFLLFITCELFILSAMSY
DRYVAICSPLLYTVIMSQGICWVLVTVPYIYSIFVSLIVTLRVFTLSFCGYNVINHFFCD
CIPLISLLCSNTHEVELIIRFFATFDLISSLLVVLVSYLFILIAILRMKSAAGRRKAFST
CGSHLTVVIVFYGTLIFMYVQPKSSQSFETDKVSSIFYTLVIPMLNPLIYSFRNKDVKDA
IERIWKKIVNSFS