Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or8k39 Olfactory Receptor

Gene Symbol Or8k39
Organism Mouse
Family 8
Subfamily k
Pseudo No
Location chr2:86732678-86733610 (-)
Aliases Olfr1089, RP23-449C14.5, MOR193-1, RP23-449C14.5, MOR193-1

Sequence information


Nucleotide sequence

ATGGAGAGACAGAACTTCACAGTCGTGAAAGATTTCATCCTGATAGGCATCACTAATCGG
CCTGAGCTGAAGGGTCCATTGTTTGGGCTGTTCCTCATCATCTATCTGATCTCATTAATG
GGAAATATGGGCATGATCATACTCACAATAGTGGACCCTCGACTGCAAACACCCATGTAC
TTCTTTCTCAAACACTTGGCTGTCACTGATCTTGGTTATTCTACAGCTGTAGGACCTAAA
ATGTTAGAAAATTTTGTCGTGAACCAAAATACAATATCCTATTATCTTTGTGCTTTACAG
CTAGCTTGCTTTCTTCTGTTCATTACCTGTGAGCTTTTTATTTTGTCTGCCATGTCCTAT
GACCACTATGTGGCCATCTGCAACCCTCTGCTCTACAATGTCATCATGTCAAAGAAGAAA
TGTTGGCTACTAATAGTAATTGCTTATCTGTATGGTTTGTTTCTGTCTCTTATAATTACT
TTAAAGATGTTCAGGCTTTCATTCTGCAGCTACAATATAATCAATCATTTTTTCTGTGAC
TGTATCCCTTTGATACCATTGCTCTGTTCAAACACTCATGAAATTCAGTTGATAATTTTA
GTATTTGCCATTTTTGATTTGATTTGTTCTCTTCTGGTTGTTCTTGTGTCTTACCTCCTC
ATCCTCATAACCATTCTGAGGATGAACTCTACTGAGGGCAGGCACAAGGCTTTTGCAACT
TGTGGATCACACATAACTGTCGTCACCGTCTTCTATGGGACTTTGATATCTATGTATTTG
CAGCCTAATTATAGTCACTCTTTTGACACTGACAAGTTGGCATCCATCTTTTATACCATG
ATTATCCCCATGTTGAATCCCTTGATCTACAGCTTGAGGAACAAGGATGTAAAGAATGCT
GGACAGAGGATATGGAAGAAGTTGTGCAAGATT


Conceptual translation

MERQNFTVVKDFILIGITNRPELKGPLFGLFLIIYLISLMGNMGMIILTIVDPRLQTPMY
FFLKHLAVTDLGYSTAVGPKMLENFVVNQNTISYYLCALQLACFLLFITCELFILSAMSY
DHYVAICNPLLYNVIMSKKKCWLLIVIAYLYGLFLSLIITLKMFRLSFCSYNIINHFFCD
CIPLIPLLCSNTHEIQLIILVFAIFDLICSLLVVLVSYLLILITILRMNSTEGRHKAFAT
CGSHITVVTVFYGTLISMYLQPNYSHSFDTDKLASIFYTMIIPMLNPLIYSLRNKDVKNA
GQRIWKKLCKI