Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or8k3b-ps Olfactory Receptor

Gene Symbol Or8k3b-ps
Organism Rat
Family 8
Subfamily k
Pseudo Yes
Location chr3:73,896,100-73,897,200 (-)
Aliases Olr511-ps

Sequence information


Conceptual translation

MEKHNLTTVTQFILMGITERPELQAPLFGLFLVIYMSSMFGNLGMIILTTVDSRLQTPMY
FFIRHLAITDLGYSTAVGPKMLVNFVVDLNIISYNLCATQLAFF/VFIISELFILSAMS
YDRYVAICKPLLYTVIMSQRVCQVLVAIPYLYCTFVSLLVTTKIFTLSFCGYNVISHFYC
DSLPLLSLICSSTHEIEMIILVLAAFNLISSLLVVLVSYLFILIAILRMNSAEGRRKAFS
TCGSHLTVVTVFYGTLIFMYVQPQSSHSFDTDKVASIFYTLIIPMLNPMIYSLRNKDVKY
ALQRALRKIYSILS