Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or8k40 Olfactory Receptor

Gene Symbol Or8k40
Organism Mouse
Family 8
Subfamily k
Pseudo No
Location chr2:86,753,800-86,754,700 (-)
Aliases Olfr1090

Sequence information


Nucleotide sequence

MKEHNLTVMTEFILMGISDHSELQAPLFGLFLAIYMTSMVGNLGIIVLTTVDSRLQTPMY
FFLRHLAITDLGYSTAVGPKMLENFVVDQNTISFNLCATQLAFFLVFIGSELFILSAMSY
DRYVAICKPLLYTVLMSQKLCWVLMSMPYLYCTFVSLLITVKIFTSSFCGYNVINHFYCD
CIPLLSLLCSHAEEIAFIVMIFAAFDLIVSLLIVLVSYMFILIAVLRMNSAEGRYKAFST
CGSHLTVVTVFYGTLIFMYVQPQSSHSDDNDKVSSIFYTLVIPMLNPLIYSLRNKDVKFA
LHRTWRNICKIFP


Conceptual translation

MKEHNLTVMTEFILMGISDHSELQAPLFGLFLAIYMTSMVGNLGIIVLTTVDSRLQTPMY
FFLRHLAITDLGYSTAVGPKMLENFVVDQNTISFNLCATQLAFFLVFIGSELFILSAMSY
DRYVAICKPLLYTVLMSQKLCWVLMSMPYLYCTFVSLLITVKIFTSSFCGYNVINHFYCD
CIPLLSLLCSHAEEIAFIVMIFAAFDLIVSLLIVLVSYMFILIAVLRMNSAEGRYKAFST
CGSHLTVVTVFYGTLIFMYVQPQSSHSDDNDKVSSIFYTLVIPMLNPLIYSLRNKDVKFA
LHRTWRNICKIFP