Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or8k41 Olfactory Receptor

Gene Symbol Or8k41
Organism Mouse
Family 8
Subfamily k
Pseudo No
Location chr2:86482802-86483740 (-)
Aliases Olfr228_Olfr1072

Sequence information


Nucleotide sequence

ATGAAAAAACAAAACTTCACAATGGTGACTGAATTCATTCTTGTGGGCATCACTGACTGC
CCTGAGCTGCAGGCTCCATTGTTTGGACTGTTCCTCATCATTTATCTGATCACACTGGTG
GGCAACTTGGGCATGATCATCCTTACCATGGTGGATTCCAGGCTACAAACACCCATGTAC
TTCTTTCTAAGACACCTCGCTACTACTGACCTTGGTTATTCAACAGCTGTGGGACCAAAA
ATGTTAAGAAATTTTCTTGTAGAACAAAATACAATATCATTTTATATTTGTGCTGTCCAG
TTAACTTTCTTCAATATGTTCATTGTTAGTGAATTTTTTATTCTGTCTGCAATGTCTTAT
GACCGCTATGTCGCCATTTGTAAACCACTCCTCTATAATGTCATTATGTCACAAAGAGTG
TGTTGGGTTCTAGTGGCCATTCCTTACATTTACAGTATATTTGTTGCTCTCCTAATCAGC
ATAAATATTTTTTCTTCATCCTTCTGTGGACACAATATTATCAGTCATTTCTATTGTGAT
GGTCTCCCCTTGATATCTCTGCTCTGCTCATATAGAAAAGAAAATGAAATGATAACTTTT
ATTTTATCAATTATTAACTTGATTACTTCACCACTGGTCATTCTTGCTTCCTATCTGCTC
ATTCTCAGAGCTATTCTCAGGATGAACTCTGCTGAAGGCAGGCAGAAGGCTTTTTCTACC
TGTGGGTCTCATCTGACAGTGGTCACTGTCTTCTATGGGACTTTGATATTTATGTATGTG
CAACCTAAGTCCAGTGACTCCTTAAAAACTGACAAGGTGGCTTCTATCTTTTATGCCCTA
ATAATCCCCATGTTAAATCCCTTGATCTACAGCTTGAGGAATAAAGATGTAAAATCTGCT
CTTAGAAAAACAGGGAAAACCATACAAAATATCTTCTCC


Conceptual translation

MKKQNFTMVTEFILVGITDCPELQAPLFGLFLIIYLITLVGNLGMIILTMVDSRLQTPMY
FFLRHLATTDLGYSTAVGPKMLRNFLVEQNTISFYICAVQLTFFNMFIVSEFFILSAMSY
DRYVAICKPLLYNVIMSQRVCWVLVAIPYIYSIFVALLISINIFSSSFCGHNIISHFYCD
GLPLISLLCSYRKENEMITFILSIINLITSPLVILASYLLILRAILRMNSAEGRQKAFST
CGSHLTVVTVFYGTLIFMYVQPKSSDSLKTDKVASIFYALIIPMLNPLIYSLRNKDVKSA
LRKTGKTIQNIFS