Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or8k42-ps Olfactory Receptor

Gene Symbol Or8k42-ps
Organism Mouse
Family 8
Subfamily k
Pseudo Yes
Location chr2:86488414-86488787 (-)
Aliases Olfr1073-ps1, MOR188-6P

Sequence information


Nucleotide sequence

ATGGTGACTGAATTCATCCTGGTGGGCATCACTTACCACCCTGAGTTTCAGGTACCATTG
TTTGGACTGTTCCTCATCATTTATCTGACCTCACTGGTTGGCAACTTGGGCATAATCATC
CTTGCCATGGTGGATTCCAGGCTGCAAACACCCATGTACTTCTTTCTCAGACATCTTGCT
ACTATAGATCTTGGTTGGAGACCAAAATGTTAAACAATTTTCTTGTAGATCAAAATACAA
TATCATTTTATGCCTGTGCTATCCAGTTATCTTTCTTTAGTATGTTCACTATTAAGAAAT
ATTTTATTCTTTCTGCAATGTCTTATGACTGTTATTTGGCCTTCTGTAAACCACTCCTCT
ACACTATCATCATG


Conceptual translation

MVTEFILVGITYHPEFQVPLFGLFLIIYLTSLVGNLGIIILAMVDSRLQTPMYFFLRHLA
TIDLGWR/KMLNNFLVDQNTISFYACAIQLSFFSMFTIKKYFILSAMSYDCYLAFCKPL
LYTIIM