Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or8k43-ps Olfactory Receptor

Gene Symbol Or8k43-ps
Organism Rat
Family 8
Subfamily k
Pseudo Yes
Location chr3:73698959-73699950 (-)
Aliases Olr498-ps, Olr498-ps

Sequence information


Nucleotide sequence

GCTACAGCCTCTATTCACAACTTGTTTTTTAATAAATCCAGATGGGGAGACAAATCCTCA
TAATAGTGGCTGAGTTTTCCTGAGGGTCATTACTGACTACCCTGAACTGCAGGCCCCATT
GTTCAGACTATCATGATCTATCTGATCTCACTAATGGTCAACACTGACATAATCATTCTT
ACCTCAGTGGAATCCAGGCTGAAACAGCAACATACTTCTTTCTCAGACACAATGCTATCA
AAGATCTTGGTTACTCGACTGCTATCAGACCTAAAATGTTAGCAAATTTTAATGTCAGTA
GAAATACAATGTCCTTTCATCTTTGTGCTACACAATTAGCCTTCTTCCTTCTGTTCATTG
ACTGTGAACTGTTTATTCTATCTCTGATGTCTATCTGTAACACACTGCTCTAAAACATCA
TGATGTTACAAATTATGTGTTGGATACTGGTGGCAATCCCATACCTTTATGGCATATTTA
TTACTTTTATAGTCAACATAAATATTTTTTTTATCCTTTTGTGACTACAATGACCTTCCT
TATATCAACTGTGATAGTCTTCCCTTGATATCCCTGCTCTGCACAAATACAGATGAAATA
GAACTGATAATTTTAATTTTATCTGCTATTAATGTATTTCCTCTTTTGTGGTCATCCTTG
ACTTCTATCTGATTATCCTAAGACCCATTCTAAGAATGAACTCTGTCGAGGGCAGGTGGA
AGTCTTTCTTTACCTGTGAGTCCCACCTGACAGTGGTCACTGTCTTTTTTGGGACTGTGA
TATTTATATTCGTGCAACATAAGAGGAGTAACTCTTTGACACTGACAAAGTAGCTTCTGT
CTTTTATAACTTAATCATCTCTATGCTGAATCCTTTGATTTACAGCTTAAGAAATAGGGG
GAGGATGGGGAGGGGAACACCCATATAGAAGGGGAGGGGAGGGGGTTAGGGGGATGTTGG
CCAGGAAACCAGGAAGGAGAATAACAATCGAA


Conceptual translation

IVAEFS*GSL/DYPELQAPLFRL/MIYLISLMVNTDIIILTSVESRL/TATYFFLRH
NAIKDLGYSTAIRPKMLANFNVSRNTMSFHLCATQLAFFLLFIDCELFILSLMSICNTLL
*NIMMLQIMCWILVAIPYLYG/IYY/L*ST*IFFLSFCDYNDLPYINCDSLPLISLLC
TNTDEIELIIL/FICY*CISSFVVILDFYLIILRPILRMNSVEGRWKSFFTCESHLTVV
TVFFGTVIFIFVQHKRSNS/DTDKVASVFYNLIISMLNPLIYSLRNRGRMG