Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or8p1-ps Olfactory Receptor

Gene Symbol Or8p1-ps
Organism Mouse
Family 8
Subfamily p
Pseudo Yes
Location chr9:38070224-38070745 (+)
Aliases Olfr886-ps1, MOR0-12P

Sequence information


Nucleotide sequence

ATGCATTTCCAGGCTAGAACCCAGGTTGTGGTCTGCTGGCCGGACACAACAATTAGGTTT
GCTGGAAGCTCTGTCCACACAGGCTGTGTCTTTCTATAAGGACATGCCATCAATCACTAA
TTGTTTAATATTCTGACCCTCCTTCAACTTTCTTGAGCCACCACCTATGTTAATAGTGGT
AATTCTGATAGGTGTATTATATCACAGTCCCCAGTTTTACCATCCTTATTTCCTATGTTT
TCATCTTCATTAACATTCTAAATATCAAATCCATGCAAAGAATATCAAAAGACTTCAGTA
TTTGTAGATTTCACATTGCTTCAATTTATGTTTTCATTGAGTTTACAGCATTCAAGTGTT
TTAAATATTCATATGGATCTATAGACCAAGGATTTTATTTTCTGTTTCTACACTGATGTG
ATACTCATCCTCAACATTATAATCTATAGTATGTGTATCATGGATGTAGAAATGGCACTT
ATGGATGCTTTGATGAAATTTCAGAGAAATGTATTTCATTTA


Conceptual translation

MHFQARTQVVVCWPDTTIRFAGSSVHTGCVFL*GHAINH*LFNILTLLQLS*ATTYVN/
W*F**VYYITVPSFTILISYVFIFINILNIKSMQRISKDFSICRFHIASIYVFIEFTAFK
CFKYSYGSIDQGFYFLF\TDVILILNIIIYSMCIMDVEMALMDALMKFQRNVFHL