Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or8u10 Olfactory Receptor

Gene Symbol Or8u10
Organism Mouse
Family 8
Subfamily u
Pseudo No
Location chr2:86084813-86085775 (-)
Aliases Olfr1037, RP23-298M2.9, MOR171-52, MOR256-34P

Sequence information


Nucleotide sequence

ATGGCTGGAAGCAATGCCACTGGTGTGACAGAATTCATTCTCTTGGGGTTTGCAGTCCAG
AGAGAGGTAGAAATCATTCTCTTTCTGCTCATTCTAGTGGTCTACAGTCTGACTTTAGTG
GGAAATGTAGGGATGATTTCACTAATCAGGATGGATTCTAGACTTCACACTCCCATGTAC
TTTTTCCTCAGTAATCTGGCCTTTGTAGACCTTTGCTATTCCTCTTCGGTAGCCCCCAAG
TTTCTGGAGACTCTCCTCAGTAACAGAAGGTCTATATCTTTCTACGCCTGTGCAACCCAA
CTCGGTTTTTTTCTGAACTTTTTGATTTCAGAGATGTTTCTCCTTGCAGTAATGGCTTAT
GACCGCTATGTGGCCATTTGTAATCCTCTTCTGTATATGGTGGTCATGTCCCAGAAGGTA
TGCCTACGACTTGTAATGGGCCCTTATTTTTACAGCTTTGCTGTTGCTTTGCTCCACACA
GTAGTTACTTTCAAACTGATTTACTGTGGCCCCAATATAATCAATCACTTTTATTGTGAT
GATGTCCCTTTGATGGCTCTTGCCTGCTCAGACACCAGCCTCAAGGAGATTTTAATATTC
ATTTTTGCTGGATTCAACATGATCAGTTCTTTGACCACTGTCCTGATTTCTTACTTATAC
ATTGTGGCTGCTATCTTAAGAATCCAGTCCACAGAAGGAAGGTGCAAAGCCTTCTCAACA
TGTGCTTCCCATCTGACTGCTGTGACTATATTCTATGGGACACTCATTTTCATGTATCTG
CAGCCAAAATCAAGCCACTCTCTCGACACAGACAAAATGGCCTCAGTATTCTACACGATT
GTAATTCCAATGCTCAATCCTATGATCTATAGCTTAAGAAATCAGGAGGTAAAGAGTGCT
CTCAGGAAAGCTCTTGAAAAATGCTACTTGTTACCTCTAATGCACCTCAAGAAAGGAATT
TCT


Conceptual translation

MAGSNATGVTEFILLGFAVQREVEIILFLLILVVYSLTLVGNVGMISLIRMDSRLHTPMY
FFLSNLAFVDLCYSSSVAPKFLETLLSNRRSISFYACATQLGFFLNFLISEMFLLAVMAY
DRYVAICNPLLYMVVMSQKVCLRLVMGPYFYSFAVALLHTVVTFKLIYCGPNIINHFYCD
DVPLMALACSDTSLKEILIFIFAGFNMISSLTTVLISYLYIVAAILRIQSTEGRCKAFST
CASHLTAVTIFYGTLIFMYLQPKSSHSLDTDKMASVFYTIVIPMLNPMIYSLRNQEVKSA
LRKALEKCYLLPLMHLKKGIS