Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or8u8 Olfactory Receptor

Gene Symbol Or8u8
Organism Mouse
Family 8
Subfamily u
Pseudo No
Location chr2:86181153-86182109 (-)
Aliases Olfr52, RP23-232A21.7, IE6, MOR185-6, ORL446, RP23-232A21.7, IE6, MOR185-6, ORL446

Sequence information


Nucleotide sequence

ATGGCTCAGATAAACTGCACCCAGGTGACAGAGTTTATTCTTGTGGGCCTCACAGATCGC
AAGGAGTTAAAGATGCCCCTCTTTGTGGTGTTCTTATTCATCTATCTTTTCACAGCAATA
GGCAATCTGGGATTGATCTTGGTCATTAGAACAGATGCAAGACTCAACACACCCATGTAC
TTCTTCCTCAGCAACCTGGCTTTTGTTGATTTCTGCTACTCCTCTGTCATTACACCTAAG
ATGCTTGGGAATTTCTTGTATAGCAAAAATGCCATATCCTTCAATGCATGTGCTGCCCAG
TTAGGCTGCTTTCTCACATTTATGGTATCAGAGTGCTTGCTCCTGGCTTCCATGGCATAT
GATAGATATGCAGCAATTTGTAACCCTCTATTGTATATGGTCACAATGTCTCCTGGAATC
TGCATTCAGCTTGTAGTTGTGCCCTATAGCTATAGTTTCCTCATGGCATTGATTCACACT
CTTCTAACCTTCCGCCTATCCTATTGCCATTCTAATATCATCAATCACTTCTACTGTGAT
GACATGCCTCTTCTCAGGCTAACTTGCTCAGATACTCACTACAAGCAGCTGTCTATTTTG
GCCTGTGCTGGAATCACATTCATTTCTTCTGTTCTGATTGTTTCTGTATCCTACATGTTC
ATTATTTCTGCCATTCTGAGGATGCGCTCAGCTGAAGGAAGACGGAAAGCCTTTTCCACC
TGTAGCTCTCACATGATGGCAGTGAGCATATTCTATGGAACTCTTATCTTTATGTACTTA
CAGCCGAGCTCTGACCATTCTCTTGATACAGATAAGATGGCCTCTGTCTTCTACACAGTG
ATCATCCCCATGTTGAACCCTTTGATCTACAGCCTCAGGAACAAGGATGTGAAAGATGCC
CTGAAGAGGGTCATGGACAATAGAAACCAGACTTCTATATTTAGAGAACTAAGAAAA


Conceptual translation

MAQINCTQVTEFILVGLTDRKELKMPLFVVFLFIYLFTAIGNLGLILVIRTDARLNTPMY
FFLSNLAFVDFCYSSVITPKMLGNFLYSKNAISFNACAAQLGCFLTFMVSECLLLASMAY
DRYAAICNPLLYMVTMSPGICIQLVVVPYSYSFLMALIHTLLTFRLSYCHSNIINHFYCD
DMPLLRLTCSDTHYKQLSILACAGITFISSVLIVSVSYMFIISAILRMRSAEGRRKAFST
CSSHMMAVSIFYGTLIFMYLQPSSDHSLDTDKMASVFYTVIIPMLNPLIYSLRNKDVKDA
LKRVMDNRNQTSIFRELRK