Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or8u8 Olfactory Receptor

Gene Symbol Or8u8
Organism Rat
Family 8
Subfamily u
Pseudo No
Location chr3:73509059-73510015 (-)
Aliases Olr483, Olr483

Sequence information


Nucleotide sequence

ATGGCTCAGATAAATTGCACCCAGGTGACAGAGTTCATTCTCATGGGCCTCACAGATCGC
AAGGAGTTGAAGATGCCTCTCTTTGTGGTATTCTTATTCATTTATCTTTTCACAGCAATA
GGCAACCTGGGACTGATCCTGGTCATTAGAACAGATGCAAGACTCAACACACCCATGTAC
TTCTTCCTCAGCAACCTGGCTTTTGTTGATTTCTGCTACTCATCTGTCATTACACCCAAG
ATGCTTGGGAATTTCTTGTACAGACATAATTTCATATCCTTCAATGCATGCGCTGCCCAG
TTAGGTTGCTTTCTCACATTTATGGTATCAGAGTGCTTGCTGCTAGCTTCCATGGCATAT
GATAGATACGCAGCCATTTGTAACCCTCTACTCTATATGGTTACAATGTCCCCTGGAATC
TGCATTCAGCTTGTAGTTGTGCCCTATAGCTATAGTTTCCTCATGGCATTGATTCACACT
CTTCTAACCTTCCGACTATCCTATTGCCACTCCAATATCATCAATCATTTCTACTGTGAT
GACATGCCTTTACTCAGGCTAACTTGCTCAGATACTCACTACAAACAGCTGTCTATTTTG
GCCTGCGCTGGAATCACATTCATTTCCTCTGTTCTGATTGTTTCTGTATCCTACATGTTC
ATTATTTCTGCCATTCTGAGGATGCGTTCAGCTGAAGGAAGACGTAAAGCCTTTTCCACC
TGCAGCTCTCACATGATGGCTGTGAGCATATTCTATGGAACTCTTATCTTTATGTACTTA
CAGCCGAGTTCTGACCACTCTCTTGATACAGATAAGATGGCCTCTGTCTTCTACACAGTG
ATCATCCCCATGCTGAATCCTTTAATCTACAGCCTCAGGAACAAGGATGTGAAAGATGCC
CTGAAGAAACTCTTGGACAATAAAAACCACACTTCTATATTTAGAGAACTAAGAAAA


Conceptual translation

MAQINCTQVTEFILMGLTDRKELKMPLFVVFLFIYLFTAIGNLGLILVIRTDARLNTPMY
FFLSNLAFVDFCYSSVITPKMLGNFLYRHNFISFNACAAQLGCFLTFMVSECLLLASMAY
DRYAAICNPLLYMVTMSPGICIQLVVVPYSYSFLMALIHTLLTFRLSYCHSNIINHFYCD
DMPLLRLTCSDTHYKQLSILACAGITFISSVLIVSVSYMFIISAILRMRSAEGRRKAFST
CSSHMMAVSIFYGTLIFMYLQPSSDHSLDTDKMASVFYTVIIPMLNPLIYSLRNKDVKDA
LKKLLDNKNHTSIFRELRK