Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or8u9 Olfactory Receptor

Gene Symbol Or8u9
Organism Mouse
Family 8
Subfamily u
Pseudo No
Location chr2:86,170,900-86,171,800 (-)
Aliases Olfr1044

Sequence information


Nucleotide sequence

MAQINCTQVTEFILVGLTDREELKMPLFVVFLSIYLFTTLGNLGLILVIRTDARLHTPMY
FFLSNLAFVDFCYSSVITPKMLGNFLYKQNMISFNACAAQLGCFLAFMTAECLLLASMAY
DRYVAICNPLLYMVLMSPGICFQLVAAPYSYSFLVALFHAILTFRLCYCHSNAINHFYCD
DMPLLRLTCSDTHSKQLWIFVCAGIMFISSLLIVFISYTFIISAILRMRSAEGRRKAFST
CGSHMLAVTIFYGTLIFMYLQPSSNHSLDTDKMASVFYTVIIPMLNPLIYSLRNKEVKDA
LKKLIASKNQMLSS


Conceptual translation

MAQINCTQVTEFILVGLTDREELKMPLFVVFLSIYLFTTLGNLGLILVIRTDARLHTPMY
FFLSNLAFVDFCYSSVITPKMLGNFLYKQNMISFNACAAQLGCFLAFMTAECLLLASMAY
DRYVAICNPLLYMVLMSPGICFQLVAAPYSYSFLVALFHAILTFRLCYCHSNAINHFYCD
DMPLLRLTCSDTHSKQLWIFVCAGIMFISSLLIVFISYTFIISAILRMRSAEGRRKAFST
CGSHMLAVTIFYGTLIFMYLQPSSNHSLDTDKMASVFYTVIIPMLNPLIYSLRNKEVKDA
LKKLIASKNQMLSS