Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or8u9 Olfactory Receptor

Gene Symbol Or8u9
Organism Rat
Family 8
Subfamily u
Pseudo No
Location chr3:73492680-73493621 (-)
Aliases Olr482, Olr482

Sequence information


Nucleotide sequence

ATGGCTCAGATAAACTGCTCCCAGGTAACAGAGTTCATTCTTGTGGGCCTCACAGATCGC
GAGGAGTTAAAGATGCCCCTGTTTGGGGTATTCTTATTCATCTATCTTTTCACAACATTT
GGCAACCTGGGTTTGATTGTGGTCATTAGAACAGACGCAAGACTCCACACACCCATGTAC
TTCTTCCTCAGCAACCTGGCTTTTGTTGATTTCTGCTACTCATCTGTCATTACACCCAAG
ATGCTTGGCAATTTCTTGTACAAACAAAATGTGATATCCTTCAATGCATGTGCTGCCCAG
TTAGGCTGTTTCCTAGCCTTCATGACAGCTGAATGCTTGCTCCTGGCTTCCATGGCCTAT
GACAGGTATGTGGCCATTTGTAACCCTCTGCTCTATATGGTCCTAATGTCCCCAGGAATC
TGTTTTCAGCTTGTAGCTGCCCCCTATCTCTACAGCTTCTTGGTAGCACTGTTTCACGCC
ACCCTCACCTTTCGCCTCTGCTATTGTCACTCAAATACCATCAATCATTTCTACTGTGAT
GACATGCCTCTCCTCAGGCTAACTTGCTCAGACACTCACTCCAAACAGCTATGGATCTTT
GTCTGCGCTGGCATCATGTTCATTTCCTCTCTTCTCATTGTGTTTATTTCCTACACATTC
ATTATTTCTGCCATTCTAAGAATGCGTTCCGCTGAAGGTAGACGCAAGGCTTTCTCGACA
TGTGGTTCCCACATGCTGGCAGTGACCATTTTCTATGGAACCCTCATTTTTATGTACTTG
CAGCCCAGTTCTAACCACTCTCTAGACACAGACAAAATGGCTTCTGTCTTCTACACAGTG
ATCATCCCCATGTTGAACCCCTTGATCTACAGCTTAAGGAACAAGGAAGTGAAGGATGCT
TTGAAGAAATTAATTATTAGTAGAAACCAAATGTTTATGTCA


Conceptual translation

MAQINCSQVTEFILVGLTDREELKMPLFGVFLFIYLFTTFGNLGLIVVIRTDARLHTPMY
FFLSNLAFVDFCYSSVITPKMLGNFLYKQNVISFNACAAQLGCFLAFMTAECLLLASMAY
DRYVAICNPLLYMVLMSPGICFQLVAAPYLYSFLVALFHATLTFRLCYCHSNTINHFYCD
DMPLLRLTCSDTHSKQLWIFVCAGIMFISSLLIVFISYTFIISAILRMRSAEGRRKAFST
CGSHMLAVTIFYGTLIFMYLQPSSNHSLDTDKMASVFYTVIIPMLNPLIYSLRNKEVKDA
LKKLIISRNQMFMS