Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or8w1 Olfactory Receptor

Gene Symbol Or8w1
Organism Mouse
Family 8
Subfamily w
Pseudo No
Location chr2:87634822-87635745 (-)
Aliases Olfr1132, RP23-463G15.8, MOR177-1, RP23-463G15.8, MOR177-1

Sequence information


Nucleotide sequence

ATGGAAAAGAAAAATTGCTCCTCAGTAGATGAATTCATCTTCTTGGGAATTACCAAGAAC
CCTGACATGAGAGTGACCTTCTTCACCACACTCCTACTTGTTTATCTCATTAATCTTCTG
GCCAACCTTGGGATGATCATCTTAATTAGAGTGAACACTCAGCTGCACACACCCATGTAC
TTTTTCCTCAGCCACCTCTCTTTCTGTGACCTCTGCTATTCCACAGCAATTGGACCCAAG
ATGTTGGTGGATCTTTTAGTTGAGGAGAAATCGATTCCCATTGTTGGTTGTGCTTTGCAG
TTTTTTACGTTCTGCATCTTTGCAGATTCTGAGTGTCTACTGCTGGCAGTGATGGCCTAT
GACAGATACCAGGCCATCAGTAACCCATTGCTCTACACAGTGAACATGTCCAGCCGGCTG
TGCTCCCTCCTGATGGCTGGAGTTTACCTGGTGGGAACAGCAGATGCTTTGATACATACA
ACCCTGACCTTCCGCTTGTGTTTCTGTGGATCCAATGAGATCAACCACTTTTTTTGTGAT
GTGCCTCCTCTTCTATTAATATCTTGCTCAGATACAGAGGTCAATGAGTTAGCTATATTC
ACAATTTTCGGGTTCATTGAGCTGAGTACCATTTCTGGAGTCCTTGTTTCTTATTGCTAC
ATCATATCATCAGTCTTGAAGATCGGTTCTGCTGAGGGGCGGTTTAAAGCTTTCTCTACC
TGTGCTTCCCACCTGACTGCTGTTGCAGTATTCCAGGGGACTATGCTCTTCATGTATTTC
CGGCCAAGTTCTGCCTACTCTCTAGATCAAGACAAAATGACCTCACTCTTCTACACCCTG
GTGATTCCAATGTTGAACCCTCTGATTTACAGCCTGAGGAACAAAGATGTGAAAGAGGCT
GTGGTAAAATTAAAGAATAAATGG


Conceptual translation

MEKKNCSSVDEFIFLGITKNPDMRVTFFTTLLLVYLINLLANLGMIILIRVNTQLHTPMY
FFLSHLSFCDLCYSTAIGPKMLVDLLVEEKSIPIVGCALQFFTFCIFADSECLLLAVMAY
DRYQAISNPLLYTVNMSSRLCSLLMAGVYLVGTADALIHTTLTFRLCFCGSNEINHFFCD
VPPLLLISCSDTEVNELAIFTIFGFIELSTISGVLVSYCYIISSVLKIGSAEGRFKAFST
CASHLTAVAVFQGTMLFMYFRPSSAYSLDQDKMTSLFYTLVIPMLNPLIYSLRNKDVKEA
VVKLKNKW