Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or8w1b Olfactory Receptor

Gene Symbol Or8w1b
Organism Rat
Family 8
Subfamily w
Pseudo No
Location chr3:75575256-75576179 (-)
Aliases Olr567, Olr567

Sequence information


Nucleotide sequence

ATGGTCAAGAGAAATTGCTCCTCTCTGGACGAATTCATTTTTTTGGGAATTACCAATAAC
CCTGAAATGAAAGTGGCCCTCTTTACCACGTTCCTACTTGTTTATCTCATTAATCTTCTG
GCCAACCTTGGGATGATAATCTTAATTAGAATGGACACTCAGTTGCACACACCCATGTAC
TTTTTCCTGAGCCACCTCTCTTTCTGTGACCTTTGCTATTCCACAGCAATTGGACCCAAG
ATGCTGGTGGATCTTTTAGCTGAGGAGAAATCAATTCCAACAGTTGGCTGTGCTCTGCAG
TTCTTCACCCTCTGTGCCTTTGTAGATTCTGAGTATCTACTGCTGGCAGTGATGGCCTAT
GATAGGTACCAGGCCATCAATAATCCATTGCTCTATACAGTGAACATGTCCAGCAGACTG
TGCTCCCTCATGATGGCTGGGGTTTACCTGGTGGGAACAGCAGATGCTTTGATACATACA
ACGCTGGCCTTCAGTTTGTGTTTCTGCAGGTCTAATGAGATCAACCACTTTTTCTGTGAT
GTTCCTACTCTTCTATTAAGATCTTGCTCGGATACAGAGGCGAATGAGTTAGCTATATTC
ACAATTTTTGGTTTTATTGAACTAAGCACAATTTCTGGACTTCTTGTCTCTTACTGTTAC
ATCATCTCATCAGTCTTGAAGATCAGCTCAGATGAGGGCAGGTTCAAAGCTTTCTCCACC
TGTGCCTCCCACTTAACAGCAGTTGCAATTTTTCAGGGAACTCTGCTCTTTATGTATTTC
TGGCCAAGTTCTTCTTACTCTCTAGATGAAGACAAAATGACCTCATTGTTCTACACCCTG
GTAATTCCAATGTTGAATCCTCTGATTTACAGCCTGAGGAACAAGGATGTGAAAGAGGCT
CTTGAAAAGTTGAAGACTAAAAGG


Conceptual translation

MVKRNCSSLDEFIFLGITNNPEMKVALFTTFLLVYLINLLANLGMIILIRMDTQLHTPMY
FFLSHLSFCDLCYSTAIGPKMLVDLLAEEKSIPTVGCALQFFTLCAFVDSEYLLLAVMAY
DRYQAINNPLLYTVNMSSRLCSLMMAGVYLVGTADALIHTTLAFSLCFCRSNEINHFFCD
VPTLLLRSCSDTEANELAIFTIFGFIELSTISGLLVSYCYIISSVLKISSDEGRFKAFST
CASHLTAVAIFQGTLLFMYFWPSSSYSLDEDKMTSLFYTLVIPMLNPLIYSLRNKDVKEA
LEKLKTKR