Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or8w5-ps Olfactory Receptor

Gene Symbol Or8w5-ps
Organism Rat
Family 8
Subfamily w
Pseudo Yes
Location chr3:75589025-75589986 (-)
Aliases Olr570-ps, Olr570-ps

Sequence information


Nucleotide sequence

CATAGGCTGTGGGGTGAGGGAGGGGAGCTGGCTCACCGATTGGACATGGATGGAAGCTCA
GAGCCAAAGATACCTTTAATTTTTAAGGTTTATCCAAGAAATGGACAAGAAAATTTATTC
CTCTCTATATGAATTCATTTTCTTGTGAATTACCTTGACATAAAAGCGGCCCTCTTCACC
ACATTCCTATTTGTTTACCTCATTAGTCTTCTGAACAATCATGGAATAATCATCTTAATT
AGAGTGGACACTCAGCCGCAAACACTCATGTATTTTATCCTCAGTCACTTCTCTTTCTGT
GACCTCTGCTATTCCCCAGCAACTGGAACCAACATGCTGGTGGGTCTTTTAGTTGAGAAG
AAATCAATTCCTAGTGTTGGTTGTGCTTTGCAGGTCTTTACATTGTATGTCTTTGCAGAT
TCTGAGTGTCTACTGCTAGCAGAATTCACCTTTGGTAGGTATAAGGCCATCAGCAACCCC
TGGCTTTATATAGTGAAGATATCCAACAGGCTGTGCTCCCTCCTAATGCCTGAGTTTTAC
CTGATGGGAACAGCAGATATTTTGATACACTCATCCCTGGCCTTCAGCTTGATTTCATGT
GAATCCCATGAGATCAGCCACATTTTTTTGTGATGCTCTTCCTCTTCTACTAATATCTTG
CCCAGATAAAGAGGCCAGTGTATTAGATATATTGACAGTTTTTTAGGTTTATTGAGCTGA
GCACCCTTTCTGGAATTTTTTTTCTCTTATTGCTACATCATATTATCAGTCTTGATGCTC
TGCTGAGGGGTGGTTTAGAGCTTTCTCCACCTGTTCCTTAGCCGAATTTAAGCAGGGCAG
CATCAGAAAATATATACTCTAAGTGTTAGTACAAATCACATGAGTCTTCATGAGGTCAAG
CTGTATACAATCAAAAGGACCAACTAAATGAGGAAGAAATATGTATTTCCTTAGAAACAT
AA


Conceptual translation

MDKKIYSSLYEFIFL/NYLDIKAALFTTFLFVYLISLLNNHGIIILIRVDTQPQTLMYF
ILSHFSFCDLCYSPATGTNMLVGLLVEKKSIPSVGCALQVFTLYVFADSECLLLAEFTFG
RYKAISNPWLYIVKISNRLCSLLMPEFYLMGTADILIHSSLAFSLISCESHEISH\FCD
ALPLLLISCPDKEASVLDILTVF*\IELSTLSGIFF\YCYIILSVL\SAEGWFRAFS
TCS