Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or8y1-ps Olfactory Receptor

Gene Symbol Or8y1-ps
Organism Mouse
Family 8
Subfamily y
Pseudo Yes
Location chr2:86389093-86389604 (-)
Aliases Olfr1059-ps1, MOR190-6_p

Sequence information


Nucleotide sequence

ACAGTGATAACCTAATTCACACTGCTGGGCATCACAAATCACACTAAGCTATAGGAATTA
CTTTCTGGGTTGTTTCTTGTCATCTGTCTGATCTCCTTCATGAGCAGCTTAGCCATAATC
CTAATTACTATGGTGGACTCCCAGCTGTAAAAACCCATGTATTTCCTTCTCAGACACAAA
GTTACTAAACTCTTTGTTTATTCAACTGCTATGGGAACCAAAATGTTAGAAATATTATTC
CACATCAAAACACAGCATCTTTTATGCTTTGTGACTTTTAGACTTAGCCATCTATCTTTT
GTTCATTGTTTGTGAGATTTTATGACCCTTATGTCAAGATTATGTTGGTTACTAGTGGAT
TTTTTTTTTAACTTTACTGCACAATTTTGACTGTCCTATTCAAAATTAAGATTTTCACTT
TGTCTTTCAGTATGTACAATGGCATCATTCATTTCTACTGTATCGATATTAATTTGTTAT
CTTTGGTCTCTCCAAGTATACACAAGATTGAA


Conceptual translation

TVIT*FTLLGITNHTKL*ELLSGLFLVICLISFMSSLAIILITMVDSQL*KPMYFLL/T
QSY*TLC\STAMGTKMLE\YSTSKHSIFYAL*LLDLAIYLLFI/L*DFMTLMSRLCW
LLVD/FF*LYCTILTVLFKIKIFTLSFSMYNGIIHFYCIDINLLSLVSPSIHKIE