Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or9f1-ps Olfactory Receptor

Gene Symbol Or9f1-ps
Organism Rat
Family 9
Subfamily f
Pseudo Yes
Location chr3:73045515-73046416 (+)
Aliases Olr449-ps, Olr449-ps

Sequence information


Nucleotide sequence

GTTCTTATTCAAAATTTTTAGGTCTTAATGAACAGAATAAAACTTGAACCTGTTTAGTCT
GCTGAGATCCCCTAGGCCATCTTTACCTTCCACAATTCCGGGCCAAATCCAAGTCACACA
TGCTGTGCCCCAGGCCAGGGTGGTGAGTCTCTGGATCCTATCACACCTGCCTTTTCTGAG
ACTTAAGTATCCCTCTGTCTATACTAAGATCCCAGTGCCTGCATCTCTGAAGACAAGAGC
ATCTCCTTGCTAGATGTCTGTTCAGTCTTCTCCACTGGATTGGCCGATAACCAGTGCTCC
CTACAGGGTGCCATGTCTTATGATTGTTATGTCGCCATATCTAATCTCCTGCTTTATGCT
CAAGCTAAGATGATTTAGCAATGCAATAAATAATGGTAACAAGCAACAGATTCATATTGA
TCTTTTATGGTGAAAGTGTCTTTGATGATTTTTTCTGTGATGTCTGGTGATGTTGGCATG
TGATGTGAGGAGAGTTTCCAGTCTGTGCTGTACTTCTTCCTAGCATCCAAAGTCATTCTT
ACCCTGTTCATTTTGTCTTCCTATCTCTTTATCATTTCTGCCATGTTGAGGATCTAATTC
ACCAAGAGCCACTTCAAGGGGTTTTCCACCTGCTTCTCATATTTAGCTCTGCGACCTTGT
ACTATGACTCCATTCTCCATGTCTACTCTTGCCCAAGTTCCAGCAACTCCCTGAAGAGGG
ACAGAATGGTGTCTACCTTTTATCCTGTCTTATTTTCCATGTTGGATCCCATGGACTACA
GTCTCAGGAATAAAGATGTGTAGAAAGCTCTGATAAAAACACTGCAGGTTAGCTTATTCT
GAAGTCTAAGTTGACATACACCTAGCAAGACAGGACTGTGTGAATACAAACTATTTGAAT
CA


Conceptual translation

WILSHLPFLRLKYPSVYTKI/SACISEDKSISLLDVCSVFSTGLADNQCSLQGAMSYDC
YVAI/*SPALCSS*DDLAMQ*IMVTSNRFILIFYGESVFDDFFCD/LVML/M*CEES
FQSVLYFFLASKVILTLFILSSYLFIISAMLRI*FTKSHFKGFSTCFSY/SSATLYYDS
ILHVYSCPSSSNSLKRDRMVSTFYPVLFSMLDPMDYSLRNKDV*KALIKTLQVSLF