Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or9g19 Olfactory Receptor

Gene Symbol Or9g19
Organism Mouse
Family 9
Subfamily g
Pseudo No
Location chr2:85769803-85770717 (+)
Aliases Olfr1013, RP23-60G16.1, MOR213-2, RP23-60G16.1, MOR213-2

Sequence information


Nucleotide sequence

ATGGATCAGAATAATAATACTGTTAGTGAGTTCATCATGTTGGGATTCACAACAGATCCT
GTGATACAGAAGGTCCTGTTTGCAGTGTTTCTTGTTGTGTACACATTGACTTTGATGGGA
AATAGCTCCCTCATTATGTTAATCTGCAATGACTCTAGGCTCCACACACCCATGTATTTC
TTCATTGGAAACCTATCATTCCTGGACCTTGGATTGTCTTCTGTCTACACACCAAAGATC
CTAGAAACCTGCATCTCAGAAGACAAGAGCATTTCCTTCGCCGGTTGTGTAGCTCAGTTC
TTCTTCTCAGCTGCACTGGACTATACTGAATGTTACCTTTTGGCTGCCATGGCTTATGAC
CGCTATGTGGCTATTTCAAAGCCACTGCTTTATTCACAAGCCATGTCCTTAAAGCTGTGT
GTGTGTTTTGTGGTAGCCTCATATGTGGGTGGTTTTATTAACTCTGTGATCATTACCAAA
GACACATTTGCTTTGACTTTCTGCAATGATAATGTAATTGATGATTTTTTCTGTGATATC
CCACCTCTGGTAAAGCTCGCATGTGGCAAGAAGAAGAGCTTTCAGTCTGTGTTATTCTTC
CTCTTGACTTCCAATGTCATCATCCCCATTGTGTTCATCCTGGCCACCTATCTCTTCATC
ATTGCCACTATCTTGAGGATCCGCTCCACTCAGGGCCGCCTCAAGGCCTTCTCCACCTGC
TCCTCCCACCTCATCTCTGTGACCTTGTACTATGGCTCCATTCTCTACATCTATGCTCGG
CCCCGGTCCAGCTACTCTTTAGATAGAGACAAAATTGTTTCAACCTTTTACACAGTGGTT
TTCCCCATGTTGAATCCCCTGATCTATAGTCTAAGGAATAAGGATGTGAAAGAGGCTCTG
AATAAACTCCTCAAG


Conceptual translation

MDQNNNTVSEFIMLGFTTDPVIQKVLFAVFLVVYTLTLMGNSSLIMLICNDSRLHTPMYF
FIGNLSFLDLGLSSVYTPKILETCISEDKSISFAGCVAQFFFSAALDYTECYLLAAMAYD
RYVAISKPLLYSQAMSLKLCVCFVVASYVGGFINSVIITKDTFALTFCNDNVIDDFFCDI
PPLVKLACGKKKSFQSVLFFLLTSNVIIPIVFILATYLFIIATILRIRSTQGRLKAFSTC
SSHLISVTLYYGSILYIYARPRSSYSLDRDKIVSTFYTVVFPMLNPLIYSLRNKDVKEAL
NKLLK