Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or9g19 Olfactory Receptor

Gene Symbol Or9g19
Organism Rat
Family 9
Subfamily g
Pseudo No
Location chr3:73,138,200-73,139,100 (+)
Aliases Olr456

Sequence information


Nucleotide sequence

ATGGATCATAATAACACTGTTAGTGAGTTCATCATGCTGGGATTCACAACAGATCCTGTG
ATGCAGAAGGTCCTGTTTGCAGTGTTTCTTATTGTGTACACATTGACTTTGATAGGAAAT
TGTTCCCTCATTATGTTAATCTGCAATGACTCTAGGCTCCACACACCCATGTATTTCTTC
ATCGGAAACCTATCATTCCTGGACCTTGGATTGTCTTCTGTCTACACACCTAAGATCCTA
GCAACCTGCATCTCTGAAGACAAGAGCATCTCCTTCGCTGGTTGCGTGACTCAGTTCTTC
TTCTCAGCTGCACTGGACTATACCGAGTGTTACCTTTTGGCTGCCATGGCTTATGACCGC
TATGTGGCTATCTCAAAGCCACTGCTTTATTCACAAGCCATGTCTTTAAAGCTGTGTGTG
TTTTTTGTGGCAGCCTCATATCTGGGTGGTTTCATTAACTCTGTGATCATCACCAAAGAC
ACATTTGCCTTGACTTTCTGCAGTGACAATGTGATTGATGACTTTTTCTGTGATATCCCA
CCTCTGGTGAAGCTCGCCTGTGGCAAGAAGGACAGCTTTCAGTCTGTGTTATTCTTCCTC
TTGACTTCCAATGTCATCATCCCCATTGTGTTCATCCTGGCCACCTATCTCTTCATCATT
GCCACTATCTTGAGGATCCGCTCCACTCAGGGCCGCCTCAAGGCTTTCTCCACCTGTTCC
TCCCACCTTATTTCTGTGACCTTGTACTATGGCTCCATCCTCTACATCTATGCTCGGCCC
AGGTCCAGCTACTCTTTAGATAGAGACAAAATTGTTTCAACCTTTTACACAGTGGTTTTC
CCCATGCTGAATCCCCTGATCTATAGTCTCAGGAATAAGGATGTGAAAGAGGCCCTGAAT
AAACTCCTCAAG


Conceptual translation

MDHNNTVSEFIMLGFTTDPVMQKVLFAVFLIVYTLTLIGNCSLIMLICNDSRLHTPMYFF
IGNLSFLDLGLSSVYTPKILATCISEDKSISFAGCVTQFFFSAALDYTECYLLAAMAYDR
YVAISKPLLYSQAMSLKLCVFFVAASYLGGFINSVIITKDTFALTFCSDNVIDDFFCDIP
PLVKLACGKKDSFQSVLFFLLTSNVIIPIVFILATYLFIIATILRIRSTQGRLKAFSTCS
SHLISVTLYYGSILYIYARPRSSYSLDRDKIVSTFYTVVFPMLNPLIYSLRNKDVKEALN
KLLK