Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or9g20 Olfactory Receptor

Gene Symbol Or9g20
Organism Rat
Family 9
Subfamily g
Pseudo No
Location chr3:73177659-73178585 (-)
Aliases Olr459, Olr459

Sequence information


Nucleotide sequence

ATGGAGAGAGGCAACCACACAGTATCTGAGTTCATTCTGTTGGGATTCACCTCTGACCCT
ACTACACAATTAGTCCTGTTTGTGATGTTTCTCATTATGTACACATTGACTGTGTTAGGA
AACTGTATTCTTATGGTGTTGATCTGCAGTGACCCCAAGCTCCACACACCCATGTATTTC
TTCATCGGAAATCTATCTTTTCTGGATCTCTGGTTGTCCACTGTCTATACTCCAAAGATC
CTAGTGATATGTATCTCTGAAAATAAAAGTATGTCCTTTGCTAGCTGTGTAGCTCAGTTC
TTCTTTTCTGCTGGACTGGACTACAGTGAGTGTTACCTGCTGGCTGCTATGGCTTATGAC
CGTTATGTGGCCATCTCAAAGCCACTGATTTATTCTCAGGCCATATCTATAAAACAATGT
GCATTTTTTGTAGCAGCCTCTTATATGGGTGGCTTTATTAACTCTTCCATCATCACTAAG
AAAACTTTTACATTTGACTTCTGTAATGACAACATCATCGATGACTTTTTTTGTGACTTG
CTTCCCTTGGTGAATCTGGCTTGCGGTGGCAAGGAAGGATACCAGGCCCTGATGTACTTC
CTCCTGACCTCCAATGTAATGATACCCATTGCCCTAATCCTGGCCTCCTATATCATCATC
ATTGCCACAATCTTGAGGATCCGATCCACCCAGGGTCGCCTGAAGGCCTTCTCTACCTGT
TCCTCCCACCTCATCTCTGTGACCTTGTATTATGGCTCCATTCTCTACATCTACTCTCGC
CCTCGTACCAGTTATTCTTTAGATACAGACAAAGTTGTTTCAACATTTTACACGGTAGTT
TTCCCCATGTTGAATCCCTTCATCTACAGCCTGAGGAATAAGGATGTGAAAGAGGCTCTG
AATAAACTCTTGAAGATCATTCCTTTG


Conceptual translation

MERGNHTVSEFILLGFTSDPTTQLVLFVMFLIMYTLTVLGNCILMVLICSDPKLHTPMYF
FIGNLSFLDLWLSTVYTPKILVICISENKSMSFASCVAQFFFSAGLDYSECYLLAAMAYD
RYVAISKPLIYSQAISIKQCAFFVAASYMGGFINSSIITKKTFTFDFCNDNIIDDFFCDL
LPLVNLACGGKEGYQALMYFLLTSNVMIPIALILASYIIIIATILRIRSTQGRLKAFSTC
SSHLISVTLYYGSILYIYSRPRTSYSLDTDKVVSTFYTVVFPMLNPFIYSLRNKDVKEAL
NKLLKIIPL