Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or9g3 Olfactory Receptor

Gene Symbol Or9g3
Organism Mouse
Family 9
Subfamily g
Pseudo No
Location chr2:85759442-85760374 (-)
Aliases Olfr1012, RP23-16D18.15, MOR213-6, RP23-16D18.15, MOR213-6

Sequence information


Nucleotide sequence

ATGGAGAGGGGCAATCACACAGTGACTGGCTTCATCTTGCTGGGCTTCTCAACAGACCCA
GTGATGCAGAAGATACTATTTGTCATGTTTCTCGGAGTATATTCCCTGACATTGCTAGGA
AACACCACCCTCATCATATTGATATGCAATGACTCCAGGCTCCACACACCCATGTATTTC
TTCATTGGGAATCTGTCTTTTCTGGATCTCTGGTATTCTTCTGTCTATACTCCAAAGATC
CTGGTGACCTGCATCTCTGAAGACAAAAGCATCTCCTTTGCAGGATGTCTGTCTCAATTC
TTTTTCTCTGCTGGATTGGCCTATAGTGAATGCTACCTACTGGCTGCCATGGCTTATGAT
CGCTACACTGCCATCTCGAATCCCCTGCTTTATGCTCAAGCTATGTCACGAAGGTTGTGT
GTCTGTTTGGTTGTATATTCCTATACAGGAGGATTTGTCAATGCAATAATATTAACTAGC
AACACATTCACATTGGACTTTTGTGGTGACAATGTCATTGATGATTTTTTCTGTGATGTC
CCACCTCTGGTGAAGTTGGCATGTGATGTCAGGGAGAGTTACCAGTCTGTGCTGTACTTC
CTCCTAGCTTCCAATGTCATTTCTCCCACTCTTCTCATCTTGACCTCCTACCTCTTCATC
ATTGCTGCCATCCTGAGGATCCGATCAACCCAGGGTCGTCTCAAGGCCTTCTCCACCTGC
TCGTCCCACCTCATCTCTGTGACCTTGTACTATGGCTCCATTCTCTACATCTACTCTCGG
CCAAGTTCCAGTTATTCCTTGGAAAGGGATAAAATGGTGTCTACCTTTTATACTGTGTTA
TTCCCCATGTTGAACCCCATGATCTACAGTCTAAGGAATAAAGATGTAAAGGAAGCTCTG
AGAAAACTCTTTAAGTTAGCTCCTTCTGAAGTC


Conceptual translation

MERGNHTVTGFILLGFSTDPVMQKILFVMFLGVYSLTLLGNTTLIILICNDSRLHTPMYF
FIGNLSFLDLWYSSVYTPKILVTCISEDKSISFAGCLSQFFFSAGLAYSECYLLAAMAYD
RYTAISNPLLYAQAMSRRLCVCLVVYSYTGGFVNAIILTSNTFTLDFCGDNVIDDFFCDV
PPLVKLACDVRESYQSVLYFLLASNVISPTLLILTSYLFIIAAILRIRSTQGRLKAFSTC
SSHLISVTLYYGSILYIYSRPSSSYSLERDKMVSTFYTVLFPMLNPMIYSLRNKDVKEAL
RKLFKLAPSEV