Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or9g3 Olfactory Receptor

Gene Symbol Or9g3
Organism Rat
Family 9
Subfamily g
Pseudo No
Location chr3:73123712-73124644 (-)
Aliases Olr455, Olr455

Sequence information


Nucleotide sequence

ATGGAGAGGAGCAACCACACAGTGACTGACTTCATCTTGCTGGGCTTCTCAACAGACCCT
GTAATGGAGAAGATACTGTTTGTCCTGTTCCTTGGAGTATATTCCATGACATTGATAGGA
AACACCACCCTCATCATATTGATCTGCAATGACTCCAGACTCCACACACCCATGTATTTC
TTCATTGGAAATCTGTCTTTTCTGGATCTCTGGTATTCCTCTGTCTATACTCCAAAGATC
CTAGTGACCTGCATCTCTGAAGACAAAAGTATCTCATTTGCTGGATGTCTGGCTCAATTC
TTCTTCTCTGCTGGATTGGCCTATAGTGAATGTTACCTACTGGCTGCCATGGCTTATGAT
CGCTACACTGCTATCTCTAATCCCCTGCTTTATGCTCAAGCTATGTCAAGAAGATTGTGC
ATCTGTTTGGTTGTATATTCCTATACAGGAGGATTTGTCAATGCAATAATATTAACTAGC
AACACATTCACATTGGACTTTTGTGGTGACAATGTCATTGATGATTTTTTCTGTGATGTT
CCACCTCTGATCAAGTTGGCATGTGATGTTAGGGAGAGTTACCAGTCTGTGCTGTACTTC
CTCTTAGCCTCTAATGTCATTTCTCCCACTCTGCTCATCTTGACCTCCTATCTGTTCATC
ATTGCTGCCATCCTGAGGATCCGATCCACCCAGGGCCGCCTCAAAGCCTTCTCTACCTGT
TCTTCACATCTCATCTCTGTGACCTTATACTATGGCTCCATTCTCTACATATACTCTCGC
CCCAGTTCCAGCTACTCCTTAGAAAGGGACAAAATGGTGTCTACCTTTTATACTGTATTA
TTCCCCATGTTGAACCCCATGATCTACAGTCTGAGGAATAAAGATGTGAAGGAAGCTCTG
AGGAAACTCTTTAAGTTAGCTCATGCTGAAGTC


Conceptual translation

MERSNHTVTDFILLGFSTDPVMEKILFVLFLGVYSMTLIGNTTLIILICNDSRLHTPMYF
FIGNLSFLDLWYSSVYTPKILVTCISEDKSISFAGCLAQFFFSAGLAYSECYLLAAMAYD
RYTAISNPLLYAQAMSRRLCICLVVYSYTGGFVNAIILTSNTFTLDFCGDNVIDDFFCDV
PPLIKLACDVRESYQSVLYFLLASNVISPTLLILTSYLFIIAAILRIRSTQGRLKAFSTC
SSHLISVTLYYGSILYIYSRPSSSYSLERDKMVSTFYTVLFPMLNPMIYSLRNKDVKEAL
RKLFKLAHAEV