Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or9g4 Olfactory Receptor

Gene Symbol Or9g4
Organism Mouse
Family 9
Subfamily g
Pseudo No
Location chr2:85674214-85675173 (-)
Aliases Olfr1006, MOR213-4, MOR213-4

Sequence information


Nucleotide sequence

ATGACCAGGTTTTCCTCTGTGGACATGGAGTTGGACAATCGTACCATCCTGACTGAATTC
ATCCTTGTGGGCTTCTCAGCAGACCCCCACTGGCAGCTGACTCTATTTGGAATATTTCTA
ACCATCTACTTGTTGACATTGTCAGGGAACATGTTGCTGGTTGTTTTAATCCGAATTGAT
TCTAGACTGCATACACCTATGTACTTTTTCATCAGCAATCTGTCATTTTTGGATTTCTGG
TATACTTCTGTATATACCCCCAAAATATTGGCCACTTGTATCTCAGAAGACAAACGCATT
TCCTTGGCTGGATGTGGGGCTCAGCTGTTCTTCTCCTGTGTTGTAGCATACACTGAGTGC
TACCTGCTGGCAGCCATGGCTTATGACCGACATTCTGCAATTTGTAGTCCATTGATCTAT
TCAAGCATCATGTCATCTTCTCTCTGTACTGGGCTAGTAGCTGGGTGTTACATAGGGGGG
GTTTTGAATGCCATAGCCCATACTGCAAACACCTTCCGGCTAACTTTCTGTGGTAAAAAT
ATTATTGACCACTTTTTCTGTGATGCACCACCCTTGGTAAAAATGTCCTGTACAGATACC
CGTGTCTATGAAAAAGTCCTCCTGGGTGTGGTGGGCTTCACGGTACTCTCCAGCATTCTT
GCCATCCTCATTTCCTACTTCAACATCCTGCTGGCTATCTTGAGGATCCGCTCAGCCTCA
GGAAGACGTAAAGCTTTCTCTACCTGTGCCTCTCACCTGGTCTCTGTCATGCTGTTCTAT
GGTTCCTTGCTTTTCATGTATTCAAGGCCTAGTTCAACCTACTCTCTAGAAAAGGACAAA
GTGGCTGCCCTCTTCTATACTGTAGTCAACCCATTGCTCAACCCTCTCATCTATAGCCTA
AGAAACAAAGATGTCAAAGATGCCTTCAGAAAAGCAACACAGACAATACGACCACACACA


Conceptual translation

MTRFSSVDMELDNRTILTEFILVGFSADPHWQLTLFGIFLTIYLLTLSGNMLLVVLIRID
SRLHTPMYFFISNLSFLDFWYTSVYTPKILATCISEDKRISLAGCGAQLFFSCVVAYTEC
YLLAAMAYDRHSAICSPLIYSSIMSSSLCTGLVAGCYIGGVLNAIAHTANTFRLTFCGKN
IIDHFFCDAPPLVKMSCTDTRVYEKVLLGVVGFTVLSSILAILISYFNILLAILRIRSAS
GRRKAFSTCASHLVSVMLFYGSLLFMYSRPSSTYSLEKDKVAALFYTVVNPLLNPLIYSL
RNKDVKDAFRKATQTIRPHT