Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or9g4b Olfactory Receptor

Gene Symbol Or9g4b
Organism Mouse
Family 9
Subfamily g
Pseudo No
Location chr2:85785513-85786448 (+)
Aliases Olfr1015, RP23-384L16.1, MOR213-3, RP23-384L16.1, MOR213-3

Sequence information


Nucleotide sequence

ATGGATGTAGACAATCGCACCATCCTGACTGAGTTTATTCTTCTGGGCTTCTCAGCAGAC
CCCCATTGGCAGCTGATTCTATTTGGAATATTTCTAACCATCTACTTGATGACCTTGTTA
GGGAACATGACCTTGATTATTTTAATCCGCATCGATTCCAGGCTGCACACACCCATGTAC
TTTTTTATTGGAGGTCTATCTTTTTTGGACTTCTGGTATAATTCTGTATACATACCAAAA
ATCTTGGTCAACTGTGTTTCAGAGGATAAGCGTATTTCTTTGGCTGGTTGTGGGGCTCAG
TTTTTCTTTTCCTGTGTAGCAGCCTACACTGAGTGCTACCTGCTGGCAGCCATGGCATAT
GATCGACACGCTGCAATTTGTAGCCCATTGCTCTATTCAAGCATCATGTCCACTTCTCTC
TGTGCTGGGTTAGTGGGGGCCTCCTATGTGGGAGGGTTTTTGAATGCCATAGCCCATACT
GCCAACACTTTCAGGCTAAGGTTCTGTGGTAAAAATATTATTGATCACTTTTTCTGTGAT
GTGCTTCCATTGGTAAAAATGTCTTGTACAGACACCCGTGTCTATGTGAAAATCCTTTCC
AGTATGGTGGGCTTCACTGTCCTCTCAAGCATTCTTGCCATCCTAATTTCCTATCTCAAC
ATCCTGCTGGCTATACTGAGGATCCGCTCAGCCTCAGGAAGACGAAAGGCTTTCTCCACC
TGTGCCTCTCACCTGGTCTCTGTTACACTCTTCTATGGTTCCCTGCTCTTCATGTATTCA
AGACCCAGTTCCAACTACTCCCTGGAGAGAGACAAAGTAGCTGCCATGTTCTATACCATC
ATCAATCCATTACTCAACCCTTTTATCTATAGTTTGAGAAACAAAGATGTCAAAGAAGCC
TTTAAGAAGTTGATGCAGACTATAAAACAGCAAACC


Conceptual translation

MDVDNRTILTEFILLGFSADPHWQLILFGIFLTIYLMTLLGNMTLIILIRIDSRLHTPMY
FFIGGLSFLDFWYNSVYIPKILVNCVSEDKRISLAGCGAQFFFSCVAAYTECYLLAAMAY
DRHAAICSPLLYSSIMSTSLCAGLVGASYVGGFLNAIAHTANTFRLRFCGKNIIDHFFCD
VLPLVKMSCTDTRVYVKILSSMVGFTVLSSILAILISYLNILLAILRIRSASGRRKAFST
CASHLVSVTLFYGSLLFMYSRPSSNYSLERDKVAAMFYTIINPLLNPFIYSLRNKDVKEA
FKKLMQTIKQQT