Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or9g8-ps Olfactory Receptor

Gene Symbol Or9g8-ps
Organism Rat
Family 9
Subfamily g
Pseudo Yes
Location chr3:73145983-73146906 (+)
Aliases Olr457-ps, Olr457-ps

Sequence information


Nucleotide sequence

ATGGAACAGTATAATGATACAGAGACTGAGTTGATCTTGCTGGGATTCACAACAGACTCT
ATCATGGAGCTGGTCCTGTTTGCTATTTTCCTTGCTGTGTATGCATTAACTGTGTTAGGA
AACAGCACCCTCATTGTGTTGATCTGCAATGACTCCAGGCTCCACACGCCCATGTATTTC
TTCATTGGAAATCTGTCTTTTCTGGATCTTGGATTGTCCACAGTCTATACACCAAAGATC
TGAGTGACCTGTATCTCTGAAGATAAAAGCATCTCTTTTGCTGGCTGCGTGGCTCAGTTC
TTCTTCTCTGCTGGACTTGGATATACTGAGTGTTACCTTTTGGCTGCCATGGCTTATGAC
CGCTATGTGGCTATCTCAAAGCCACTGCTTTATTCCCAAGCCATGTCTTTAAAGCTGTGT
GCATTTTTAGTGGGAGCCTCATATCTGGGTGGTTTAATAAACTCTTTCATCATCACCAAA
GACACATTTGCCTTGACTTTCTGCAGTGACAATGTAATTGATGACTTTTTCTGTGATATC
CCACCTCTGGTGAAGCTCGCCTGTGGCAAGAAGGACAGCTTTCAGTCTGTGTTATTCTTT
CTCTTGACTTCCAATGTCATCATCCCCATTGTGTTCATTCTGGCCACCTATCTCTTCATC
ATTGCCACTATCTTGAGGATCCGCTCCACTCAGGGCCGCCTCAAGGCTTTCTCCACATGT
TCCTCCCACCTTATCTCTGTGACATTGTACTATGGCTCCATTCTCTACATCTATGCTCGG
CCCCAGTCCAGCTATTCTTTAGATAGAGACAAAATTGTTTCAACCTTTTACACAGTGGTT
TTCCCCATGTTGAATCCCCTGATCTATAGTCTCAGGAATAAGGATGTGAAAGAGGCTCTG
AATAAATTGTTCAAACAATCACAA


Conceptual translation

MEQYNDTETELILLGFTTDSIMELVLFAIFLAVYALTVLGNSTLIVLICNDSRLHTPMYF
FIGNLSFLDLGLSTVYTPKI*VTCISEDKSISFAGCVAQFFFSAGLGYTECYLLAAMAYD
RYVAISKPLLYSQAMSLKLCAFLVGASYLGGLINSFIITKDTFALTFCSDNVIDDFFCDI
PPLVKLACGKKDSFQSVLFFLLTSNVIIPIVFILATYLFIIATILRIRSTQGRLKAFSTC
SSHLISVTLYYGSILYIYARPQSSYSLDRDKIVSTFYTVVFPMLNPLIYSLRNKDVKEAL
NKLFKQSQ