Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or9g8 Olfactory Receptor

Gene Symbol Or9g8
Organism Mouse
Family 9
Subfamily g
Pseudo No
Location chr2:85776586-85777500 (+)
Aliases Olfr1014, RP23-60G16.2, MOR213-5, RP23-60G16.2, MOR213-5

Sequence information


Nucleotide sequence

ATGGAACAATATAATGATACAGTGACTGAGTTCATCCTGGTAGGATTCACAACAAACCCT
GTCATGCAGCTGGTTCTGCTTGTTATTTTTCTTGCTGTGTATGCATTAACTGTGTTAGGA
AACAGCACCCTCATTGTGTTGATCTGCAATGACTCTAGGCTCCATACACCCATGTATTTC
TTCATTGGAAATCTGTCTTTTCTGGATCTTGGATTGTCCACAGTCTATACACCAAAGATC
TTAGTGACCTGCATCTCTGAAGATAAAAGCATCTCCTTTTCTGGCTGTGTGGCTCAGTTC
TTCTTCTCTGCTGGACTTGGGTATACTGAGTGTTATCTGTTGGCTGCCATGGCTTATGAC
CGCTATGTCGCTATCTCAAAGCCACTGCTTTATTCCCAAGCCATGTCCTTAAAGCTATGT
GCATTTTTAGTTGGAGTCTCATATTTGGGTGGTTTAATTAACTCTTTCATAATCACCAAA
GACACATTTGCCTTGACTTTCTGCAATGATAATGTAATTGATGACTTTTTCTGTGATATC
CCACCCCTGGTAAAGCTCTCATGTGGCAAAAAGAAGAGCTTTCAGTCTGTGTTATTCTTC
CTTTTGACTTCCAATGTCATCATCCCCATTGTGTTCATCCTGGCCACCTATCTCTTCATC
ATTGCCACTATCTTGAGGATCCGCTCCACTCAGGGCCGCCTCAAGGCCTTCTCCACCTGC
TCCTCCCACCTCATCTCTGTGACCTTGTACTATGGCTCCATTCTCTACATCTATGCTCGG
CCCCGGTCCAGCTACTCTTTAGATAGAGACAAAATTGTTTCAACCTTTTACACAGTGGTT
TTCCCCATGTTGAATCCCCTGATCTATAGTCTGAGGAATAAGGATGTGAAAGAGGCTTTG
AGTAAACTGTTCAAA


Conceptual translation

MEQYNDTVTEFILVGFTTNPVMQLVLLVIFLAVYALTVLGNSTLIVLICNDSRLHTPMYF
FIGNLSFLDLGLSTVYTPKILVTCISEDKSISFSGCVAQFFFSAGLGYTECYLLAAMAYD
RYVAISKPLLYSQAMSLKLCAFLVGVSYLGGLINSFIITKDTFALTFCNDNVIDDFFCDI
PPLVKLSCGKKKSFQSVLFFLLTSNVIIPIVFILATYLFIIATILRIRSTQGRLKAFSTC
SSHLISVTLYYGSILYIYARPRSSYSLDRDKIVSTFYTVVFPMLNPLIYSLRNKDVKEAL
SKLFK