Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or9i1-ps Olfactory Receptor

Gene Symbol Or9i1-ps
Organism Rat
Family 9
Subfamily i
Pseudo Yes
Location chr1:230703607-230704754 (+)
Aliases Olr381-ps, Olr381-ps

Sequence information


Nucleotide sequence

AATTTAATTCCTATCACAAGGAAAAAAAACTATACTTCAGTTGTGGTTTCTTTATAATTC
ACTCTTGTCTTCTGATGAACAAACTGTCTACATTGAATCCATGGCCAAGAATAATGTCAC
AACAGTAACTGAATTCATCCTAATGGGATTTAATGACCACCCCAATTGGGAGATTCCCCT
CTTTCTGGTGTTTCTTAGCTTATATCTTGTCACTATCCTGGGAAACTTGGGCATGATCAT
TCTCATCCATATAGATGTTCAACTCCACATACCTATGTACTTCTTCCTGAGCCACCTCTC
TGTGTTGGATACTTGTTATACCTCAGTCATCACTCCTCAGATTCTTGTCACACTGGCTAC
AGGCAAAACAGCCATTTCCTATGATAGCTGTGCTGCCCAGTTCTTCTTCTTCACTGTTTG
TGCAGGTACAGAATGTTTCCTACTCTCTGTGATGGCCTATGATCGCTATGTTGCTATTAG
CAAACCACTGCTCTATACTGTGGCCATGCACCCTAGGAAATGTTGGAGTTTGGTAGTAGA
AGCATATCTTTGTGGAGTGTCTGGAGCCATCCTGCATACCACATTTACTTTCTCCCTCTC
CTTCTGTGAAAAATAACCAGATCAATTTCTTTTTTTGTGACTTCCCACCCCTGCTGAAGC
TGGCCTGTAGTAACACAGCAAATGTTGAAAGTATTGTCTTCTTTGGGAATTTTGTGATTT
TGGCAAATGCCTTTGTTATACTCATTTCCTACCTGCTTATCATCAAAGCTGTCATGAAAA
TGAAGTTTTCAGGAAGAAGAGCCAAGACTTTCTCAACATGTGTCTCCCACCTCACTGCTG
TGGCTCTTTTATTTGGGACCCTTATCTTTATGTATATGCGAAGTGGTTCAAAAAATCCCT
GGAAGAAGATAAAGTTGTGTCTGTCTTCTACACTATTGTCATTCCCATGCTGAATCCACT
AATCTATAGCCTAAGAAACAAGGATGTGAAATCTGCCTTCAAGAAGGTTATTGGTAAATG
CCAGGTCTCACACAGTATGCAACACTGAGTGAGAAGCCTTCTCATCTTGGTCAAGTTTGT
CAGTGTATTCTATTAGACTCCAGGACAGCATGCGTGCTATACTTATTAATATAGTAGACA
AGTCATAA


Conceptual translation

MAKNNVTTVTEFILMGFNDHPNWEIPLFLVFLSLYLVTILGNLGMIILIHIDVQLHIPMY
FFLSHLSVLDTCYTSVITPQILVTLATGKTAISYDSCAAQFFFFTVCAGTECFLLSVMAY
DRYVAISKPLLYTVAMHPRKCWSLVVEAYLCGVSGAILHTTFTFSLSFC\NNQINFFFC
DFPPLLKLACSNTANVESIVFFGNFVILANAFVILISYLLIIKAVMKMKFSGRRAKTFST
CVSHLTAVALLFGTLIFMYMRSGS/KSLEEDKVVSVFYTIVIPMLNPLIYSLRNKDVKS
AFKKVIGKCQV