Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or9i1 Olfactory Receptor

Gene Symbol Or9i1
Organism Mouse
Family 9
Subfamily i
Pseudo No
Location chr19:13861795-13862742 (+)
Aliases Olfr1502, MGC123714, MGC123715, MOR211-1, MGC123714, MGC123715, MOR211-1

Sequence information


Nucleotide sequence

ATGGCCAAGAATAACATTACCACAGTAACGGAATTCATCCTAATAGGCTTTAATGACCAC
CCCAAGTGGGAGATTCCACTATTGCTGGTATTTCTTAGCTTTTATCTTGTCACCATGCTG
GGAAATTTGGGCATGGTCATTCTTATCCATGTAGATGTCCAACTCCACATCCCAATGTAC
TTCTTTCTGAGCCATCTCTCTGTGTTGGATGCCTGCTATACTTCAGTCATCACCCCTCAG
ATACTGGCAACGCTGGCTACAGGTAAAACAGTCATTTCCTATAGATGTTGTGCTGCCCAG
TTCTTCTTCTTCACTATCTGTGCAGCTACAGAATGTTTCCTGCTGTCTGTGATGGCCTAT
GATCGCTATGTTGCTATTAGCAATCCACTGCTCTACACTGTGGCCATGGGCCCTAGAAAA
TGTTGGAGTTTAGTAGTAGGAGCATATATCTGTGGAGTGTGTGGGGCCATTCTGCGTACC
ACATGCACCTTCTCTCTCTCCTTCTGTGAAAATAATCAGATCAATTTCTTCTTTTGTGAC
CTCCCACCTCTGCTGAAGCTGGCCTGTAGTGACACAACAAATATTGAAATTATCATTGTC
TTCTTTGGGAATTTTGTAATTTTGGCCAATGCCTTAGTCATCCTCATTTCCTACCTGCTC
ATCATCAAAGCTGTCATGAGAATGAAGTCTTCAGGTAGAAGAGCAAAGACTTTCTCAACA
TGTGTCTCCCACCTCACTGCTGTGGCTCTTTTATTTGGGACACTCATCTTTATGTACATA
CGTAGTGGTTCAAAAAAATCCCTGGATGAAGATAAAGTTGTGTCTGTCTTCTACACTGTG
GTCATTCCCATGCTGAACCCACTAATCTACAGCCTAAGGAACAAGGATGTCAAGGCTGCA
TTCAAGAAGGTGACTGGTAAATGCCAGGTTTCCCAATGCACACAACAC


Conceptual translation

MAKNNITTVTEFILIGFNDHPKWEIPLLLVFLSFYLVTMLGNLGMVILIHVDVQLHIPMY
FFLSHLSVLDACYTSVITPQILATLATGKTVISYRCCAAQFFFFTICAATECFLLSVMAY
DRYVAISNPLLYTVAMGPRKCWSLVVGAYICGVCGAILRTTCTFSLSFCENNQINFFFCD
LPPLLKLACSDTTNIEIIIVFFGNFVILANALVILISYLLIIKAVMRMKSSGRRAKTFST
CVSHLTAVALLFGTLIFMYIRSGSKKSLDEDKVVSVFYTVVIPMLNPLIYSLRNKDVKAA
FKKVTGKCQVSQCTQH