Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or9i14 Olfactory Receptor

Gene Symbol Or9i14
Organism Mouse
Family 9
Subfamily i
Pseudo No
Location chr19:13,814,600-13,815,600 (-)
Aliases Olfr1499

Sequence information


Nucleotide sequence

MDNNNLTTVTEFILVGFTDHPEWEVPLFLVFLCFYLVTILGNLGMVILIQMDVQLQSPMY
FFLSHLSVLDACYTSVITPQILAMLATGKTVISYNHCAAQFFFFTFCASTECFLLAVMSY
DRYVAISNPLLYTVAMSPKKCWSLVLVAYVCGLSGSIQRTTCTFSLSFCEDNKINFFFCD
LPPLLKLACSDTTNAEIIIVLFGNFVILVNALVILTSYLLIIKTVMRIKSSGGRGKTFST
CVSHLTAVALFFGTLTFMYIRSGSGKSPEEDKVVSVFYTVIIPMLNPLIYSLRNKDVKAG
FRKLTSRLQVSQSV


Conceptual translation

MDNNNLTTVTEFILVGFTDHPEWEVPLFLVFLCFYLVTILGNLGMVILIQMDVQLQSPMY
FFLSHLSVLDACYTSVITPQILAMLATGKTVISYNHCAAQFFFFTFCASTECFLLAVMSY
DRYVAISNPLLYTVAMSPKKCWSLVLVAYVCGLSGSIQRTTCTFSLSFCEDNKINFFFCD
LPPLLKLACSDTTNAEIIIVLFGNFVILVNALVILTSYLLIIKTVMRIKSSGGRGKTFST
CVSHLTAVALFFGTLTFMYIRSGSGKSPEEDKVVSVFYTVIIPMLNPLIYSLRNKDVKAG
FRKLTSRLQVSQSV