Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or9i14 Olfactory Receptor

Gene Symbol Or9i14
Organism Rat
Family 9
Subfamily i
Pseudo No
Location chr1:230729013-230729978 (-)
Aliases Olr382, Olr382

Sequence information


Nucleotide sequence

ATGAGTAAACAGTCTGCACTGAATATGGACAATAAAAGCCTCACCACAGTAACAGAATTT
ATTCTCACGGGCTTTACTGACCATCCCGAGTGGGAGATTCCTCTTTTCCTAGTCTTTCTT
TGCTTCTATCTGATCACCATCTTGGGGAACTTGGGCATGGTCATTCTTATCCAGATGGAT
GCACAACTTCAGACCCCAATGTACTTCTTCCTGAGCCATCTCTCTGTAATGGATGCTTGC
TACACCAGTGTCATCACCCCTCAGATCCTGGCCATGCTGGCCACAGAGAAAACAGTCATC
TCCTATGGTCATTGTGCTGCCCAGTTCTTCTTTTTCACCTTCTGTGCAAGTACTGAGTGT
TTCCTGTTGGCAGTGATGTCCTATGATCGGTATGTTGCTATTAGCAGCCCTCTGCTCTAC
ACTGTGGCCATGAGTCCTAAAAAATGCTGGAGTTTGGTACTGGGAGCCTATGTATGTGGA
TTATCTGGGTCCATTCAAAGAACTACATGTACATTTTCTCTCTCGTTCTGTGAAGACAAT
GAGATCAACTTTTTCTTTTGTGACCTTCCACCCTTGCTGAAACTGGCCTGCAGTGACACA
ACAAATGCTGAGATTGTAATTGTTTTGTTTGGGAACTTTGTCATCTTGGTGAATGCTTTA
GTCATACTCATTTCCTACCTGCTCATCATCAAGACAGTCACGATGATGAAGTCTTCCGGA
GGCAGAGGTAAAACATTCTCCACATGTGTGTCCCACCTTACTGCCGTGGCTCTTTTTTTT
GGGACCCTCACCTTCATGTATATAAGAAGTGGTTCAGAGACATCCCTAGAAGAAGATAAA
GTTGTGTCTGTCTTCTATACTGTGATTATCCCCATGTTGAACCCTCTGATCTACAGCTTG
AGAAATAAAGACGTTAAAGCAGCCTTCAGAAAACTCAGTAACAGGCTACATGTGTCCCAG
CATGTA


Conceptual translation

MSKQSALNMDNKSLTTVTEFILTGFTDHPEWEIPLFLVFLCFYLITILGNLGMVILIQMD
AQLQTPMYFFLSHLSVMDACYTSVITPQILAMLATEKTVISYGHCAAQFFFFTFCASTEC
FLLAVMSYDRYVAISSPLLYTVAMSPKKCWSLVLGAYVCGLSGSIQRTTCTFSLSFCEDN
EINFFFCDLPPLLKLACSDTTNAEIVIVLFGNFVILVNALVILISYLLIIKTVTMMKSSG
GRGKTFSTCVSHLTAVALFFGTLTFMYIRSGSETSLEEDKVVSVFYTVIIPMLNPLIYSL
RNKDVKAAFRKLSNRLHVSQHV