Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or9i16 Olfactory Receptor

Gene Symbol Or9i16
Organism Rat
Family 9
Subfamily i
Pseudo No
Location chr1:230686213-230687157 (-)
Aliases Olr380, Olr380

Sequence information


Nucleotide sequence

ATGGCAGACAATGGCACCAGGTTGACAGAATTTATTCTGATGGGGTTCCAGCTTCAGGCA
GAGCTACGGTTGGGTCTCTTCTTCATGTTTTTGTCCTTTTATCTCATCACCATTGTTGGA
AACCTGGGCATGATCATGCTAATTCAGAGTGATCCTCAGCTCCACACACCTATGTACTTC
TTCCTCAGCCATTTGTCTTTTCTAGACATTTGCTATTCATCTGTTATTGTGCCCCAGCTC
CTGGAGACCTTGGGGAATAATGAGGTGGTCTTCACTTATGAGCGTTGTGTCACCCAGTTC
TTCTTTTTCACCTTTTATGGTAGTACTGAGTGTTTCCTTTTGGCTGTAATGGCCTATGAT
CGTTATGTGGCTATATGCAACCCTCTCCTTTATGCCATGGCCATGACACCACAGACTCGC
CTGGGGCTGGTTGCTTTAGCATACTCTGGTGCAATGGTAAATGGTGTGGTCCGATCTGGG
TGTACATTTTCCATTTCCTTCTGTAAATCTAACCAAGTTGATTTCTTTTTTTGTGACCTC
CCACCCTTGCTGAATCTTGCCTGTAGTGAGACCAAGTTACGGGAACAGGTGATCTTCCTT
TTTGCTTTTTTGGTCATCATAACTAGTGTTTCAGTGATTCTTGTATCTTACCTATTCATT
ATCTGGGCTATTCGGAAGATTCGTACAGCAGGCGCCAAAGCCAAGACCTTCTCTACTTGT
GCATCTCACATGATTGTAGTGGCTCTTTTTTTTGGAACACTAATATTCATGTACTTGAAA
GGTAACATTGGAAAATCCCTCTGGGAGGACAAGATTGTGTCTGTATTCTATACAGTGGTT
ATCCCTATGCTGAACCCCATGATCTATAGCCTGAGGAACAAGGAAGTGAAGGAAGCTCTG
AAGAAAGCTTTCAAAAGAATTACGACTTCTCAAGAAAGTTCAATT


Conceptual translation

MADNGTRLTEFILMGFQLQAELRLGLFFMFLSFYLITIVGNLGMIMLIQSDPQLHTPMYF
FLSHLSFLDICYSSVIVPQLLETLGNNEVVFTYERCVTQFFFFTFYGSTECFLLAVMAYD
RYVAICNPLLYAMAMTPQTRLGLVALAYSGAMVNGVVRSGCTFSISFCKSNQVDFFFCDL
PPLLNLACSETKLREQVIFLFAFLVIITSVSVILVSYLFIIWAIRKIRTAGAKAKTFSTC
ASHMIVVALFFGTLIFMYLKGNIGKSLWEDKIVSVFYTVVIPMLNPMIYSLRNKEVKEAL
KKAFKRITTSQESSI