Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or9i2 Olfactory Receptor

Gene Symbol Or9i2
Organism Rat
Family 9
Subfamily i
Pseudo No
Location chr1:230,766,000-230,767,000 (-)
Aliases Olr383

Sequence information


Nucleotide sequence

ATGGCAGACAATGGCACCAGGTTGACAGAATTTATTCTGATGGGATTCCAGCTTCAGGCT
GAGATACAGTTGGGTCTCTTCTTCATGTTTTTGGCCTTTTATCTCATCACTATTGTTGGA
AACCTGGGCATGATCATGCTAATTCAGAGTGATCCTCAGCTCCACACACCTATGTACTTC
TTCCTCAGCCATTTGTCCTTTCTAGACATTTGCTATTCATCTGTTATTGTGCCCCAGCTG
CTGGAGACCTTGGGGAATAATAAGATGGTCATCACTTATGAGCGCTGTGCCACTCAGTTC
TTCTTTTTCACCTTGTATGCTAGTACTGAGTGTTTCCTTTTGGCTGTAATGGCCTATGAC
CGTTATGTAGCTGTATGTAATCCCCTCCTTTATGCCATGGCCATGACACCACAGACTCGC
CTGGGGCTGATTGCTGCAGCATACTCTGGTGCAATGGTAAATACTGTGGTCCGAACTGGG
TGTACTTTTTCCATTTCCTTCTGTAAATCTAACCAGGTTGATTTCTTTTTTTGTGACCTC
CCACCCCTGCTGAAGCTTGCCTGTAGTGAGACCAAGTTACGAGAACAGGTGATTTTCCTT
TTGGCTTTTTTGGTCATCATAACTAGCGTTTCAGTGATTCTTGTATCTTACCTATTCATT
ATCTGGGCTATTCTGAAGATTCGTACAGCAGGCGCCAAAGCCAAGACCTTCTCTACTTGT
GCATCTCACATGATTGCAGTGGCTCTTTTTTTTGGAACACTAATGTTCATGTACTTGAAA
GGTAACATGGGCAAATCCCTCTGGGAAGACAAGATTGTGTCTGTATTCTACACGGTGGTT
ATCCCTATGCTGAACCCCATGATCTATAGCCTGAGGAACAAGGAAGTGAAGGAGGCGCTG
AAGAAAGCTTTGAAAAGAATTAAGGCTTTTCAAGAAAGTAAGACT


Conceptual translation

MADNGTRLTEFILMGFQLQAEIQLGLFFMFLAFYLITIVGNLGMIMLIQSDPQLHTPMYF
FLSHLSFLDICYSSVIVPQLLETLGNNKMVITYERCATQFFFFTLYASTECFLLAVMAYD
RYVAVCNPLLYAMAMTPQTRLGLIAAAYSGAMVNTVVRTGCTFSISFCKSNQVDFFFCDL
PPLLKLACSETKLREQVIFLLAFLVIITSVSVILVSYLFIIWAILKIRTAGAKAKTFSTC
ASHMIAVALFFGTLMFMYLKGNMGKSLWEDKIVSVFYTVVIPMLNPMIYSLRNKEVKEAL
KKALKRIKAFQESKT