Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or9m1-ps Olfactory Receptor

Gene Symbol Or9m1-ps
Organism Rat
Family 9
Subfamily m
Pseudo Yes
Location chr3:76154819-76155589 (+)
Aliases Olr605-ps, Olr605-ps

Sequence information


Nucleotide sequence

TATTTACACATTCCCATGTACTTTTTCCTCTGTATTCTGTCCTTCACAGATGCATGCTAC
TCTTCTGCCATTGCCCCCAAATTACTTGTGGATCTCATTTCTGACAAGAAGGTAATTTCT
TATAATGGCTGTGCTACACAACTGTACTTTGTCTGCACTCTGGCTAACACAGAATCTTTC
CTTTTGGCTGCTATGGCTTATGACAGGTACATTGCAATCTGTAACCCCCTGCTTTATACT
GTAATTATGTCCAAGAGAGTCTGTACTCAGCTAGCATTTGGTGCATTCTTAAGTGGAACT
ATGAGTTCAATAATCCATACTACTAATACATTCCAGTTGTCATTCTGCTCCAAAGAAATT
AACCATTTCTTTTGTGATATCTCTCCACTCTTCTCTCTGTCATGCTCTGATACCTATATA
CATGACATAATATTGGTGGTTTTTGCAAGTTTGGTGGAAGCTCTCTCTCTTCTTACTGTT
CTCCTCTCTTATACGTATATTATCGTGGCCATTTTTAAAACAGGTTCTGCAGAGGGAAGA
AAGAAAGGGTTCTCTACTTGTGCTTCTCACCTGACAATAATCACCATTTATCATGGCACC
CTGATTTACATTTATGTGCGTCCTAGTACAGGGCATTCAATGGATACTGACAAAATGACC
TCTGTGTTCTATACATTGATTATACCCATGCTTAACCCCTTGATATACAGTCTCAGGAAC
AGAGATGTCAAATTTGCCTTCAGAAAAATCATTAGGAAGAATGTATTTTCT


Conceptual translation

MHLENSTVKTEFLLLGFSDHPKLQTLLFAVFFSIYSVTLMGNIRMILLITVSP\LHIPM
YFFLCILSFTDACYSSAIAPKLLVDLISDKKVISYNGCATQLYFVCTLANTESFLLAAMA
YDRYIAICNPLLYTVIMSKRVCTQLAFGAFLSGTMSSIIHTTNTFQLSFCSKEINHFFCD
ISPLFSLSCSDTYIHDIILVVFASLVEALSLLTVLLSYTYIIVAIFKTGSAEGRKKGFST
CASHLTIITIYHGTLIYIYVRPSTGHSMDTDKMTSVFYTLIIPMLNPLIYSLRNRDVKFA
FRKIIRKNVFS